| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | Z54171.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 2461 |
| Right | 2661 |
| Strand | + |
| Nucleotide Sequence | ATGTTTAGAGAATATAAAATATATAAGTTTTTTGAACAAGTTAAACAAGAAACTTATAAAGTATTTTGGCCAAATAAAAAGGAGTTGATTGCTTCAACATTAGTAGTAGTAGCAACAGTTTTTATTTTTAGTTTAATTTGCTTGGTGCTTGATTATAGTATACATAATATAATGCAGCTTTTGCTTACTATTGGTAAATAG |
| Sequence | MFREYKIYKFFEQVKQETYKVFWPNKKELIASTLVVVATVFIFSLICLVLDYSIHNIMQLLLTIGK |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 8892818 9823893 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | P50054 |
| ORF Length (Amino Acid) | 66 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 154750 | 154950 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 157133 | 157333 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 180144 | 180344 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 174812 | 175012 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 5 | 178367 | 178567 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 66646 | 66846 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 7 | 493106 | 493306 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 8 | 1274929 | 1275129 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 9 | 156782 | 156982 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 10 | 177243 | 177443 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 11 | 181572 | 181778 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 12 | 1254330 | 1254530 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 13 | 1756791 | 1756952 | - | NZ_LR778174.1 | Veillonella parvula |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00890.26 | 0.92 | 12 | 4404.5 | same-strand | FAD binding domain |
| 2 | PF02910.22 | 0.92 | 12 | 4404.5 | same-strand | Fumarate reductase flavoprotein C-term |
| 3 | PF00528.24 | 0.92 | 12 | 3589.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 4 | PF00164.27 | 0.92 | 12 | 3040.0 | same-strand | Ribosomal protein S12/S23 |
| 5 | PF00177.23 | 0.92 | 12 | 2531.0 | same-strand | Ribosomal protein S7p/S5e |
| 6 | PF00009.29 | 1.0 | 13 | 422 | same-strand | Elongation factor Tu GTP binding domain |
| 7 | PF03764.20 | 0.92 | 12 | 421.5 | same-strand | Elongation factor G, domain IV |
| 8 | PF14492.8 | 0.92 | 12 | 421.5 | same-strand | Elongation Factor G, domain III |
| 9 | PF00679.26 | 0.92 | 12 | 421.5 | same-strand | Elongation factor G C-terminus |
| 10 | PF03144.27 | 1.0 | 13 | 422 | same-strand | Elongation factor Tu domain 2 |
| 11 | PF02357.21 | 1.0 | 13 | 16 | same-strand | Transcription termination factor nusG |
| 12 | PF00467.31 | 1.0 | 13 | 16 | same-strand | KOW motif |
| 13 | PF03946.16 | 1.0 | 13 | 827 | same-strand | Ribosomal protein L11, N-terminal domain |
| 14 | PF00298.21 | 1.0 | 13 | 827 | same-strand | Ribosomal protein L11, RNA binding domain |
| 15 | PF00687.23 | 1.0 | 13 | 1270 | same-strand | Ribosomal protein L1p/L10e family |
| 16 | PF00466.22 | 1.0 | 13 | 2130 | same-strand | Ribosomal protein L10 |
| 17 | PF00542.21 | 1.0 | 13 | 2771 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 18 | PF16320.7 | 1.0 | 13 | 2771 | same-strand | Ribosomal protein L7/L12 dimerisation domain |