Result : P50054

Protein Information

• Protein name: Protein translocase subunit SecE
• NCBI Accession ID: Z54171.1
• Organism: Rickettsia prowazekii (strain Madrid E)
• Left: 2461
• Right: 2661
• Strand: +
• Nucleotide Sequence: ATGTTTAGAGAATATAAAATATATAAGTTTTTTGAACAAGTTAAACAAGAAACTTATAAAGTATTTTGGCCAAATAAAAAGGAGTTGATTGCTTCAACATTAGTAGTAGTAGCAACAGTTTTTATTTTTAGTTTAATTTGCTTGGTGCTTGATTATAGTATACATAATATAATGCAGCTTTTGCTTACTATTGGTAAATAG
• Sequence: MFREYKIYKFFEQVKQETYKVFWPNKKELIASTLVVVATVFIFSLICLVLDYSIHNIMQLLLTIGK
• Source of smORF: Swiss-Prot
• Function: Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}.
• Pubmed ID: 8892818 9823893
• Domain: CDD:412402
• Functional Category: Others
• Uniprot ID: P50054
• ORF Length (Amino Acid): 66

Conservation Analysis

No. of Species: 13

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	154750	154950	+	NC_017049.1	Rickettsia prowazekii str. Chernikova
2	157133	157333	+	NC_017066.1	Rickettsia typhi str. TH1527
3	180144	180344	+	NZ_AP019864.1	Rickettsia heilongjiangensis
4	174812	175012	+	NC_003103.1	Rickettsia conorii str. Malish 7
5	178367	178567	+	NC_016639.1	Rickettsia slovaca 13-B
6	66646	66846	-	NZ_AP019563.1	Rickettsia asiatica
7	493106	493306	+	NZ_LN794217.1	Rickettsia monacensis
8	1274929	1275129	-	NC_017058.1	Rickettsia australis str. Cutlack
9	156782	156982	+	NC_016929.1	Rickettsia canadensis str. CA410
10	177243	177443	+	NC_010263.3	Rickettsia rickettsii str. Iowa
11	181572	181778	+	NC_009881.1	Rickettsia akari str. Hartford
12	1254330	1254530	-	NC_007940.1	Rickettsia bellii RML369-C
13	1756791	1756952	-	NZ_LR778174.1	Veillonella parvula

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_017049.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00890.26	0.92	12	4404.5	same-strand	FAD binding domain
2	PF02910.22	0.92	12	4404.5	same-strand	Fumarate reductase flavoprotein C-term
3	PF00528.24	0.92	12	3589.0	same-strand	Binding-protein-dependent transport system inner membrane component
4	PF00164.27	0.92	12	3040.0	same-strand	Ribosomal protein S12/S23
5	PF00177.23	0.92	12	2531.0	same-strand	Ribosomal protein S7p/S5e
6	PF00009.29	1.0	13	422	same-strand	Elongation factor Tu GTP binding domain
7	PF03764.20	0.92	12	421.5	same-strand	Elongation factor G, domain IV
8	PF14492.8	0.92	12	421.5	same-strand	Elongation Factor G, domain III
9	PF00679.26	0.92	12	421.5	same-strand	Elongation factor G C-terminus
10	PF03144.27	1.0	13	422	same-strand	Elongation factor Tu domain 2
11	PF02357.21	1.0	13	16	same-strand	Transcription termination factor nusG
12	PF00467.31	1.0	13	16	same-strand	KOW motif
13	PF03946.16	1.0	13	827	same-strand	Ribosomal protein L11, N-terminal domain
14	PF00298.21	1.0	13	827	same-strand	Ribosomal protein L11, RNA binding domain
15	PF00687.23	1.0	13	1270	same-strand	Ribosomal protein L1p/L10e family
16	PF00466.22	1.0	13	2130	same-strand	Ribosomal protein L10
17	PF00542.21	1.0	13	2771	same-strand	Ribosomal protein L7/L12 C-terminal domain
18	PF16320.7	1.0	13	2771	same-strand	Ribosomal protein L7/L12 dimerisation domain