| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqhV |
| NCBI Accession ID | U35252.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 290 |
| Right | 571 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTTTTACTTGGAAATATCAATTCTACTGTTTTAACAATGGCGGGATTACGAGTTTTATCCTCTATGATTGAGCTGACGGCAGCAATTGTCATGCTTGTGACCAACGATGTCCGGAAGGCGGTTGTGGTTAACAGCATTCTCGCTATTGTCGGTCCGTTGATTTTTATCATTACAATGACTGTCGGAATCTACCAAATTGCCGGGCAGCTTTCGTATGCAAAGCTGATTCTGATTTTTACGGGTGTTGTCTTGATTTTGGCGGGTGTTCATAAATAA |
| Sequence | MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVVNSILAIVGPLIFIITMTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10942. Profile Description: Protein of unknown function (DUF2619). This bacterial family of proteins has no known function. |
| Pubmed ID | 8969508 9384377 1766372 |
| Domain | CDD:402497 |
| Functional Category | Others |
| Uniprot ID | P49779 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2537689 | 2537970 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2410641 | 2410922 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2411869 | 2412150 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2397442 | 2397723 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2500491 | 2500772 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2334911 | 2335192 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3719386 | 3719667 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1509477 | 1509758 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2490198 | 2490479 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2531856 | 2532137 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2685428 | 2685709 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2807628 | 2807909 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2231812 | 2232093 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 3143226 | 3143456 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 3054583 | 3054864 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1414935 | 1415216 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2489608 | 2489889 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 18 | 2948292 | 2948573 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 1517908 | 1518189 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 2028794 | 2029075 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 4240729 | 4241010 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 22 | 1882252 | 1882497 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 1635788 | 1636030 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 24 | 2065513 | 2065755 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09546.12 | 1.0 | 24 | 2164.0 | same-strand | Stage III sporulation protein AE (spore III AE) |
| 2 | PF06686.13 | 1.0 | 24 | 1681.5 | same-strand | Stage III sporulation protein AC/AD protein family |
| 3 | PF09548.12 | 1.0 | 24 | 993.0 | same-strand | Stage III sporulation protein AB (spore III AB) |
| 4 | PF19568.1 | 1.0 | 24 | 76.0 | same-strand | Sporulation stage III, protein AA |
| 5 | PF08207.14 | 0.96 | 23 | 148 | same-strand | Elongation factor P (EF-P) KOW-like domain |
| 6 | PF09285.13 | 0.96 | 23 | 148 | same-strand | Elongation factor P, C-terminal |
| 7 | PF01132.22 | 0.96 | 23 | 148 | same-strand | Elongation factor P (EF-P) OB domain |
| 8 | PF00557.26 | 0.96 | 23 | 732 | same-strand | Metallopeptidase family M24 |
| 9 | PF01321.20 | 0.96 | 23 | 732 | same-strand | Creatinase/Prolidase N-terminal domain |
| 10 | PF01220.21 | 0.79 | 19 | 1796 | same-strand | Dehydroquinase class II |
| 11 | PF11085.10 | 0.88 | 21 | 2320 | same-strand | Conserved membrane protein YqhR |
| 12 | PF07136.13 | 0.88 | 21 | 3084 | opposite-strand | Protein of unknown function (DUF1385) |