Result : P49172
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 2-hydroxymuconate tautomerase (EC 5.3.2.6) (4-oxalocrotonate tautomerase) (4-OT) |
| NCBI Accession ID | X60835.1 |
| Organism | Pseudomonas sp. (strain CF600) |
| Left | 3662 |
| Right | 3853 |
| Strand | + |
| Nucleotide Sequence | ATGCCGATTGCTCAGCTTTACATCATCGAAGGTCGTACCGACGAGCAGAAGGAAACCTTGATCCGCCAAGTCAGCGAAGCCATGGCGAACTCGCTGGATGCACCCCTCGAGCGGGTGCGTGTGCTCATTACCGAAATGCCGAAGAATCACTTCGGCATTGGTGGCGAGCCGGCAAGCAAGGTCAGGCGCTAG |
| Sequence | MPIAQLYIIEGRTDEQKETLIRQVSEAMANSLDAPLERVRVLITEMPKNHFGIGGEPASKVRR |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the ketonization of 2-hydroxymuconate stereoselectively to yield 2-oxo-3-hexenedioate. |
| Pubmed ID | 1732207 8547259 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | P49172 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4267514 | 4267705 | - | NZ_CP020931.1 | Marinobacter salarius |
| 2 | 2613157 | 2613348 | - | NZ_CP020931.1 | Marinobacter salarius |
| 3 | 2960329 | 2960520 | - | NZ_CP017715.1 | Marinobacter salinus |
| 4 | 1696814 | 1697005 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 5 | 1736428 | 1736619 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 6 | 4274326 | 4274517 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 7 | 1143908 | 1144099 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 8 | 641999 | 642190 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 9 | 168672 | 168863 | - | NZ_CP053834.1 | Arcobacter cloacae |
| 10 | 287634 | 287825 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 11 | 2569387 | 2569578 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 12 | 381723 | 381914 | + | NZ_CP022992.1 | Paraburkholderia aromaticivorans |
| 13 | 337418 | 337609 | + | NZ_CP022992.1 | Paraburkholderia aromaticivorans |
| 14 | 4721368 | 4721559 | + | NC_023018.2 | Pandoraea pnomenusa |
| 15 | 999940 | 1000131 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 16 | 1028154 | 1028345 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 17 | 194671 | 194862 | + | NZ_CP013452.1 | Burkholderia cenocepacia |
| 18 | 2516022 | 2516213 | - | NZ_CP045236.1 | Burkholderia cepacia |
| 19 | 4532718 | 4532909 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 20 | 3657362 | 3657553 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 21 | 1829137 | 1829328 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 22 | 1297561 | 1297752 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 23 | 47299 | 47490 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 24 | 3406725 | 3406916 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 25 | 3342986 | 3343177 | - | NC_007511.1 | Burkholderia lata |
| 26 | 479192 | 479383 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 27 | 993644 | 993835 | - | NZ_LR134313.1 | Neisseria canis |
| 28 | 1682564 | 1682755 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 29 | 3729246 | 3729437 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 30 | 732839 | 733030 | + | NZ_CP040449.1 | Aeromonas simiae |
| 31 | 620403 | 620594 | + | NZ_CP039288.1 | Cupriavidus necator H16 |
| 32 | 4022160 | 4022351 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 33 | 386748 | 386939 | + | NZ_CP014646.1 | Thauera humireducens |
| 34 | 3580216 | 3580413 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 35 | 3816835 | 3817026 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 36 | 4117236 | 4117427 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 37 | 2254389 | 2254580 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 38 | 1042867 | 1043058 | + | NZ_CP062804.1 | Cupriavidus basilensis |
| 39 | 825304 | 825495 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 40 | 2954442 | 2954645 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 41 | 2190822 | 2191013 | - | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 42 | 2890207 | 2890398 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 43 | 996046 | 996237 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 44 | 3145933 | 3146124 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 45 | 2423431 | 2423622 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 46 | 1561409 | 1561600 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 47 | 922005 | 922184 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 48 | 958966 | 959163 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 49 | 2657443 | 2657634 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 50 | 3882762 | 3882959 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 51 | 816141 | 816338 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 52 | 731759 | 731959 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 53 | 370745 | 370936 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 54 | 52159 | 52365 | + | NZ_CP016623.1 | Parageobacillus thermoglucosidasius |
| 55 | 4218009 | 4218194 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043869.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00682.21 | 0.88 | 42 | 822.0 | same-strand | HMGL-like |
| 2 | PF07836.13 | 0.88 | 42 | 822.0 | same-strand | DmpG-like communication domain |
| 3 | PF09290.13 | 0.88 | 42 | 1863.0 | same-strand | Prokaryotic acetaldehyde dehydrogenase, dimerisation |
| 4 | PF01118.26 | 0.88 | 42 | 1863.0 | same-strand | Semialdehyde dehydrogenase, NAD binding domain |
| 5 | PF01557.20 | 0.75 | 36 | 2814.0 | same-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 6 | PF00171.24 | 0.71 | 34 | 3526 | same-strand | Aldehyde dehydrogenase family |
++ More..