ProsmORF-pred
Result : P48949
Protein Information
Information Type Description
Protein name 30S ribosomal protein S21
NCBI Accession ID BA000022.2
Organism Synechocystis sp. (strain PCC 6803 / Kazusa)
Left 2448222
Right 2448404
Strand -
Nucleotide Sequence ATGACTCAAGTTGTTGTAGGTCAAAACGAACCAATTGAATCCGCGCTACGCCGCTTTAAGCGTCAGGTCGCTAAGGCTGGCATCTATACAGATTTCAAAAAGCATCAATTTTTTGAAACGCCGCAAGAAAAGCATAAACGCAAGGAAGCAACCCGCAGAAGACAGCGTTCCCGTCGTCGTTAG
Sequence MTQVVVGQNEPIESALRRFKRQVAKAGIYTDFKKHQFFETPQEKHKRKEATRRRQRSRRR
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed
Pubmed ID 8590279 8905231
Domain CDD:412427
Functional Category Ribosomal_protein
Uniprot ID P48949
ORF Length (Amino Acid) 60
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 61
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2764758 2764940 - NC_014501.1 Gloeothece verrucosa PCC 7822
2 2531777 2531965 - NC_014501.1 Gloeothece verrucosa PCC 7822
3 2709105 2709314 - NC_014501.1 Gloeothece verrucosa PCC 7822
4 2792066 2792254 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
5 2911977 2912168 - NZ_CP031941.1 Nostoc sphaeroides
6 2379068 2379256 - NZ_CP031941.1 Nostoc sphaeroides
7 3940917 3941096 - NZ_CP031941.1 Nostoc sphaeroides
8 1801274 1801465 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
9 475461 475649 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
10 5549416 5549595 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
11 3541844 3542038 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
12 1335551 1335730 + NZ_CP042326.1 Euhalothece natronophila Z-M001
13 832008 832184 - NC_019689.1 Pleurocapsa sp. PCC 7327
14 3079725 3079916 - NC_019689.1 Pleurocapsa sp. PCC 7327
15 2356339 2356515 - NZ_CP021983.2 Halomicronema hongdechloris C2206
16 3590484 3590672 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
17 7149920 7150111 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
18 6080097 6080276 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
19 2744329 2744505 - NC_019771.1 Anabaena cylindrica PCC 7122
20 3397714 3397908 - NC_019771.1 Anabaena cylindrica PCC 7122
21 1135410 1135598 + NC_010628.1 Nostoc punctiforme PCC 73102
22 5407215 5407394 - NC_010628.1 Nostoc punctiforme PCC 73102
23 158248 158424 - NC_019780.1 Dactylococcopsis salina PCC 8305
24 3298411 3298605 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
25 4154470 4154649 + NC_019751.1 Calothrix sp. PCC 6303
26 5429517 5429708 + NC_019751.1 Calothrix sp. PCC 6303
27 3589189 3589365 + NC_019776.1 Cyanobacterium aponinum PCC 10605
28 3671511 3671693 - NC_019693.1 Oscillatoria acuminata PCC 6304
29 2895862 2896041 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
30 2899409 2899603 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
31 4768650 4768844 - NC_014248.1 'Nostoc azollae' 0708
32 3053971 3054162 + NC_019753.1 Crinalium epipsammum PCC 9333
33 5271782 5271961 + NC_019753.1 Crinalium epipsammum PCC 9333
34 740992 741180 + NZ_CP047242.1 Trichormus variabilis 0441
35 505399 505575 + NZ_CP047242.1 Trichormus variabilis 0441
36 2858496 2858672 + NC_019748.1 Stanieria cyanosphaera PCC 7437
37 394558 394737 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
38 52976 53164 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
39 556189 556368 - NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
40 5609413 5609583 - NC_009925.1 Acaryochloris marina MBIC11017
41 1082717 1082899 + NC_022600.1 Gloeobacter kilaueensis JS1
42 2388962 2389138 - NZ_CP014170.1 Clostridium tyrobutyricum
43 910343 910519 + NC_011837.1 Clostridium kluyveri NBRC 12016
44 3140877 3141053 + NZ_CP012395.1 Clostridium autoethanogenum DSM 10061
45 891560 891736 + NC_014328.1 Clostridium ljungdahlii DSM 13528
46 488354 488530 + NZ_CP020953.1 Clostridium drakei
47 5259682 5259858 + NZ_CP011803.1 Clostridium carboxidivorans P7
48 3758754 3758930 - NZ_CP009933.1 Clostridium scatologenes
49 453887 454069 - NZ_CP017269.1 Geosporobacter ferrireducens
50 2317242 2317418 - NZ_CP032416.1 Clostridium fermenticellae
51 1271162 1271362 - NC_016024.1 Chloracidobacterium thermophilum B
52 905608 905784 + NC_014377.1 Thermosediminibacter oceani DSM 16646
53 1362849 1363025 + NZ_CP011366.1 Salinicoccus halodurans
54 2919120 2919296 + NZ_CP071376.1 Clostridium gasigenes
55 1708402 1708584 - NC_008593.1 Clostridium novyi NT
56 1476261 1476437 + NZ_LR699011.1 Roseburia hominis
57 1749935 1750111 + NZ_LR027880.1 Roseburia intestinalis L1-82
58 1960615 1960788 + NZ_CP023643.1 Brochothrix thermosphacta
59 3196418 3196594 - NC_010001.1 Lachnoclostridium phytofermentans ISDg
60 2145695 2145871 - NZ_CP021850.1 Pseudoclostridium thermosuccinogenes
61 1264002 1264202 + NC_013894.1 Thermocrinis albus DSM 14484
62 1519361 1519537 + NC_014387.1 Butyrivibrio proteoclasticus B316
63 1101230 1101406 - NZ_CP068061.1 Mammaliicoccus vitulinus
64 1056872 1057048 + NZ_CP022046.2 Mammaliicoccus sciuri
65 4052996 4053169 + NZ_CP068053.1 Peribacillus psychrosaccharolyticus
66 734211 734384 - NZ_CP030926.1 Peribacillus butanolivorans
67 4426840 4427013 + NZ_CP017704.1 Peribacillus simplex NBRC 15720 = DSM 1321
68 1148038 1148214 + NZ_LT906462.1 Mammaliicoccus stepanovicii
69 1518580 1518756 - NZ_CP054482.1 Macrococcus bohemicus
70 1026067 1026231 + NZ_CP018092.1 Synechococcus lividus PCC 6715
71 341225 341401 + NZ_CP065729.1 Macrococcus caseolyticus
72 1375282 1375458 - NZ_CP047361.1 Macrococcus canis
73 591179 591355 + NZ_CP010450.1 Streptococcus pyogenes
74 1148005 1148181 - NZ_LR594050.1 Streptococcus porcinus
75 2031130 2031306 + NZ_LR134341.1 Streptococcus pseudoporcinus
76 914604 914780 + NZ_CP012805.1 Streptococcus anginosus
77 1309939 1310115 - NZ_LR594049.1 Streptococcus gordonii
78 1140099 1140275 - NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
++ More..