Result : P47663
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S15 |
| NCBI Accession ID | L43967.2 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Left | 531220 |
| Right | 531480 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTGATAAAGAACAAATCATTAAGGCTCATCAACTTCACAAAAACGATGTTGGCAGTGTGCAAGTACAAATCTCTATATTAACAGATCAGATTAAAAAATTAACAGACCACCTGTTAGCAAACAAAAAGGATTTTATTTCTAAGCGTGGTTTATATACAAAGGTATCAAAAAGAAAACGGCTACTTAAATATCTAAAAGAACGTAATATTGAAACCTACCGTGATTTGATTAAAAATTTAAACCTCCGGGGTTAA |
| Sequence | MKIDKEQIIKAHQLHKNDVGSVQVQISILTDQIKKLTDHLLANKKDFISKRGLYTKVSKRKRLLKYLKERNIETYRDLIKNLNLRG |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}. |
| Pubmed ID | 7569993 |
| Domain | CDD:412325 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P47663 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 111
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 531220 | 531480 | - | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 750228 | 750488 | - | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 3 | 93865 | 94137 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 4 | 95369 | 95641 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 5 | 1424888 | 1425154 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 6 | 96281 | 96547 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 7 | 535797 | 536063 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 8 | 1712901 | 1713167 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 9 | 1107697 | 1107963 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 10 | 1150402 | 1150668 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 11 | 1493985 | 1494251 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 12 | 1584798 | 1585064 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 13 | 1946537 | 1946800 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 14 | 1072331 | 1072594 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 15 | 1429424 | 1429693 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 16 | 1452405 | 1452674 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 17 | 82959 | 83222 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 18 | 1200830 | 1201096 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 19 | 1453676 | 1453945 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 20 | 961647 | 961913 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 21 | 846224 | 846496 | - | NZ_LR215023.1 | Mycoplasma iowae |
| 22 | 2215389 | 2215655 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 23 | 1238735 | 1239004 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 24 | 1806002 | 1806268 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 25 | 1361080 | 1361343 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 26 | 1053493 | 1053714 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 27 | 192132 | 192401 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 28 | 682852 | 683118 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 29 | 2494996 | 2495265 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 30 | 2375336 | 2375605 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 31 | 1270241 | 1270510 | + | NZ_CP053073.1 | Usitatibacter palustris |
| 32 | 2173707 | 2173970 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 33 | 508626 | 508898 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 34 | 847604 | 847870 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 35 | 1336327 | 1336590 | - | NC_008593.1 | Clostridium novyi NT |
| 36 | 1569366 | 1569635 | + | NZ_CP038018.1 | Eikenella exigua |
| 37 | 717106 | 717375 | - | NZ_LT906482.1 | Eikenella corrodens |
| 38 | 3369633 | 3369899 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 39 | 1209009 | 1209278 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 40 | 507324 | 507611 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 41 | 1637920 | 1638183 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 42 | 1149462 | 1149728 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 43 | 534250 | 534516 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 44 | 1397239 | 1397508 | + | NZ_CP053069.1 | Usitatibacter rugosus |
| 45 | 1163064 | 1163333 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 46 | 1575188 | 1575433 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 47 | 610205 | 610471 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 48 | 692345 | 692566 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 49 | 1692960 | 1693226 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 50 | 1312120 | 1312383 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 51 | 2239650 | 2239871 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 52 | 788493 | 788759 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 53 | 1414745 | 1415014 | + | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 54 | 1855059 | 1855322 | - | NZ_HG917868.1 | Clostridium bornimense |
| 55 | 156195 | 156458 | - | NZ_CP023671.1 | Clostridium septicum |
| 56 | 2312296 | 2312559 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 57 | 991740 | 992006 | + | NZ_LN879430.1 | Herbinix luporum |
| 58 | 1287596 | 1287862 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 59 | 1127109 | 1127372 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 60 | 2177046 | 2177309 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 61 | 2063090 | 2063353 | - | NZ_CP009687.1 | Clostridium aceticum |
| 62 | 862191 | 862457 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 63 | 858351 | 858617 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 64 | 858502 | 858768 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 65 | 1887706 | 1887963 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 66 | 418715 | 418990 | + | NZ_CP038254.1 | Legionella israelensis |
| 67 | 3334523 | 3334774 | + | NZ_CP070062.1 | Coprococcus comes |
| 68 | 1185477 | 1185746 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 69 | 2723785 | 2724054 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 70 | 2694741 | 2694962 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 71 | 1868267 | 1868536 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 72 | 2868036 | 2868305 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 73 | 216824 | 217108 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 74 | 2062813 | 2063079 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 75 | 965638 | 965901 | + | NZ_CP038213.1 | Ornithinimicrobium flavum |
| 76 | 872667 | 872933 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 77 | 3653827 | 3654063 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 78 | 1417779 | 1418015 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 79 | 525573 | 525845 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 80 | 2816887 | 2817153 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 81 | 2881496 | 2881765 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 82 | 822342 | 822581 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 83 | 1180634 | 1180900 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 84 | 3321010 | 3321276 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 85 | 332765 | 333007 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 86 | 3376381 | 3376620 | + | NZ_CP034437.1 | Paenibacillus albus |
| 87 | 3382516 | 3382737 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 88 | 4094266 | 4094541 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 89 | 1421797 | 1422063 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 90 | 3130565 | 3130840 | - | NZ_CP013742.1 | Legionella pneumophila |
| 91 | 848489 | 848755 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 92 | 1772277 | 1772540 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 93 | 1072139 | 1072411 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 94 | 307815 | 308081 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 95 | 898450 | 898716 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 96 | 569330 | 569602 | - | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 97 | 1555491 | 1555754 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 98 | 740587 | 740853 | + | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 99 | 2136178 | 2136417 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 100 | 2448539 | 2448808 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 101 | 1826462 | 1826719 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 102 | 3052623 | 3052889 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 103 | 1321232 | 1321501 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 104 | 856343 | 856612 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
| 105 | 341585 | 341854 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 106 | 709735 | 709998 | + | NZ_CP029256.1 | Christensenella minuta |
| 107 | 3097099 | 3097338 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 108 | 89512 | 89781 | - | NZ_CP059564.1 | Alysiella filiformis |
| 109 | 755567 | 755830 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 110 | 777238 | 777507 | - | NZ_LT635457.1 | Actinomyces pacaensis |
| 111 | 1435604 | 1435870 | + | NZ_CP059571.1 | Neisseria bacilliformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007514.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02033.20 | 0.63 | 70 | 2849.5 | same-strand | Ribosome-binding factor A |
| 2 | PF01509.20 | 0.65 | 72 | 1046.5 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 3 | PF01138.23 | 0.88 | 98 | 115.0 | same-strand | 3' exoribonuclease family, domain 1 |
| 4 | PF03725.17 | 0.84 | 93 | 113 | same-strand | 3' exoribonuclease family, domain 2 |
| 5 | PF00575.25 | 0.88 | 98 | 135 | same-strand | S1 RNA binding domain |
| 6 | PF00013.31 | 0.8 | 89 | 125 | same-strand | KH domain |
| 7 | PF03726.16 | 0.86 | 96 | 115.0 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
++ More..