Result : P47529
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein homolog (ACP) |
| NCBI Accession ID | L43967.2 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Left | 348883 |
| Right | 349137 |
| Strand | + |
| Nucleotide Sequence | ATGCAAACGCATGAAATTCTTTTAAAAATTAAAGAAATTGCTAAATCAAAAAACTTTAATCTTAATTTAGATGAAAAGACAATAAATCAACCACTTCGTGAGTTGAAAATCGATTCACTTGATATGTTTAGTATTGTTGTTAGTCTAGAAAATGAATTTGGGATTAGTTTTGATGATGAAAAGTTAATGAATCTAAAAAATCTTGCTGACTTGGTTTTAGAAGTTAAAAACCTTTTAGCAAAAAAAGGGGTATAG |
| Sequence | MQTHEILLKIKEIAKSKNFNLNLDEKTINQPLRELKIDSLDMFSIVVSLENEFGISFDDEKLMNLKNLADLVLEVKNLLAKKGV |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000250}. |
| Pubmed ID | 7569993 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | P47529 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 348883 | 349137 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 485449 | 485703 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 3 | 325286 | 325519 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000908.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17533.4 | 0.67 | 2 | 72.5 | same-strand | Family of unknown function (DUF5452) |
++ More..