| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein MG233 |
| NCBI Accession ID | L43967.2 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Left | 279200 |
| Right | 279499 |
| Strand | + |
| Nucleotide Sequence | ATGATTAAGATTAATATCTCCCAAAACTTTCTAGTTGCAAAAGGTCATGCTTTGTTTGCTGAGAAGGGTAAGGACATAGTTTGTGCTGCAATTAGTGGAATTATCTTTGGGGGGGTGGCTTGGTTTGAACCTGATAAGATTGAATTTACTGAAAATAAATTAGTACCTAGTATAGCACTGAAACTCATTGACCCAACCCCTAATGTAGCAGTTGCTTTTAGTGTTATTACAGTACAATTAAAAGCAATAGCCAATTCCTATCCTAATCACATAGTTATCAATGAAGAGAGTTATGAGTAA |
| Sequence | MIKINISQNFLVAKGHALFAEKGKDIVCAAISGIIFGGVAWFEPDKIEFTENKLVPSIALKLIDPTPNVAVAFSVITVQLKAIANSYPNHIVINEESYE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01080. Profile Description: ribosomal-processing cysteine protease Prp and similar proteins. This is a family of cysteine protease that are found to cleave the N-terminus extension of ribosomal subunit L27 in eubacteria. Proteins in this family are distinguished by a pair of invariant histidine and cysteine residues with conserved spacing that form the classic catalytic dyad of a cysteine protease. |
| Pubmed ID | 7569993 8253680 |
| Domain | CDD:412732 |
| Functional Category | Others |
| Uniprot ID | P47475 |
| ORF Length (Amino Acid) | 99 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 279200 | 279499 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 384557 | 384859 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07972.13 | 1.0 | 2 | 2601.5 | same-strand | NrdI Flavodoxin like |
| 2 | PF08343.12 | 1.0 | 2 | 952.0 | same-strand | Ribonucleotide reductase N-terminal |
| 3 | PF00317.23 | 1.0 | 2 | 952.0 | same-strand | Ribonucleotide reductase, all-alpha domain |
| 4 | PF00829.23 | 1.0 | 2 | -7.0 | same-strand | Ribosomal prokaryotic L21 protein |
| 5 | PF01016.21 | 1.0 | 2 | -7.0 | same-strand | Ribosomal L27 protein |
| 6 | PF01261.26 | 1.0 | 2 | 300.0 | same-strand | Xylose isomerase-like TIM barrel |
| 7 | PF11428.10 | 1.0 | 2 | 1580.0 | same-strand | Protein of unknown function (DUF3196) |
| 8 | PF05698.16 | 1.0 | 2 | 2608.5 | same-strand | Bacterial trigger factor protein (TF) C-terminus |
| 9 | PF00254.30 | 1.0 | 2 | 2608.5 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |