Result : P46887
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YecH |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1989251 |
| Right | 1989490 |
| Strand | - |
| Nucleotide Sequence | ATGGACTCTATTCACGGTCATGAAGTGTTAAATATGATGATTGAATCAGGCGAGCAATATACGCATGCCAGTCTGGAAGCTGCGATTAAAGCGCGTTTTGGTGAACAGGCACGTTTTCACACCTGCTCGGCAGAAGGGATGACAGCGGGAGAGCTGGTAGCGTTTCTGGCAGCAAAAGGCAAATTTATACCTTCGAAAGACGGTTTTTCGACCGATCAGAGTAAGATTTGCCGTCACTGA |
| Sequence | MDSIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKGKFIPSKDGFSTDQSKICRH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11278. Profile Description: Protein of unknown function (DUF2492). This model describes a family of small cytosolic proteins, about 80 amino acids in length, in which the eight invariant residues include three His residues and two Cys residues. Two pairs of these invariant residues occur in motifs HxH (where x is A or G) and CxH, both of which suggest metal-binding activity. This protein family was identified by searching with a phylogenetic profile based on an anaerobic sulfatase-maturase enzyme, which contains multiple 4Fe-4S clusters. The linkages by phylogenetic profiling and by iron-sulfur cluster-related motifs together suggest this protein may be an accessory protein to certain maturases in sulfatase/maturase systems. |
| Pubmed ID | 9097040 9278503 16738553 |
| Domain | CDD:416196 |
| Functional Category | Others |
| Uniprot ID | P46887 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 95
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1989251 | 1989490 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2590539 | 2590778 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2565759 | 2565998 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1985534 | 1985773 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2553477 | 2553716 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1920084 | 1920323 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 107376 | 107615 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 1488070 | 1488309 | - | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 2029931 | 2030170 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 10 | 699579 | 699818 | - | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 4239857 | 4240096 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 4433997 | 4434236 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 1025805 | 1026044 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 2080031 | 2080270 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 15 | 40851 | 41090 | - | NZ_CP053416.1 | Salmonella bongori |
| 16 | 2695959 | 2696198 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 17 | 1804100 | 1804339 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 18 | 2818668 | 2818871 | - | NC_015968.1 | Enterobacter soli |
| 19 | 2941456 | 2941695 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 20 | 2129518 | 2129757 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 21 | 3075062 | 3075301 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 22 | 127431 | 127670 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 23 | 30314 | 30553 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 24 | 3869904 | 3870143 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 25 | 2639811 | 2640050 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 26 | 1791153 | 1791392 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 27 | 597820 | 598023 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 28 | 1878187 | 1878426 | + | NZ_CP054254.1 | Klebsiella variicola |
| 29 | 2034052 | 2034291 | + | NZ_CP050508.1 | Raoultella terrigena |
| 30 | 2269529 | 2269768 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 31 | 1643436 | 1643675 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 32 | 4433884 | 4434123 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 33 | 2759613 | 2759852 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 34 | 3401739 | 3401978 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 35 | 2175269 | 2175508 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 36 | 1922048 | 1922287 | + | NZ_CP041247.1 | Raoultella electrica |
| 37 | 2885862 | 2886101 | + | NZ_CP050150.1 | Hafnia alvei |
| 38 | 1983589 | 1983828 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 39 | 5283476 | 5283715 | - | NZ_CP026047.1 | Raoultella planticola |
| 40 | 2597261 | 2597500 | + | NZ_LR134531.1 | Pragia fontium |
| 41 | 1810143 | 1810382 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 42 | 1943368 | 1943607 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 43 | 2851567 | 2851806 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 44 | 91295 | 91534 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 45 | 2004228 | 2004467 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 46 | 1904301 | 1904507 | + | NZ_CP036278.1 | Aeoliella mucimassa |
| 47 | 2057750 | 2057989 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 48 | 749123 | 749362 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 49 | 3536037 | 3536276 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 50 | 1335796 | 1336035 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 51 | 4214205 | 4214444 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 52 | 2106043 | 2106282 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 53 | 2768683 | 2768922 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 54 | 2018272 | 2018511 | - | NZ_CP025799.1 | Dickeya zeae |
| 55 | 3685271 | 3685510 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 56 | 2004871 | 2005110 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 57 | 1939558 | 1939797 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 58 | 2086909 | 2087148 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 59 | 2884324 | 2884563 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 60 | 1341916 | 1342119 | - | NZ_LS483470.1 | Leminorella richardii |
| 61 | 2989866 | 2990105 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 62 | 2002368 | 2002607 | - | NZ_LT615367.1 | Dickeya aquatica |
| 63 | 1996965 | 1997204 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 64 | 2195716 | 2195955 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 65 | 738966 | 739205 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 66 | 1316166 | 1316405 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 67 | 2794089 | 2794328 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 68 | 2930743 | 2930946 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 69 | 1259034 | 1259237 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 70 | 2670596 | 2670835 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 71 | 2464371 | 2464610 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 72 | 112669 | 112872 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 73 | 394633 | 394872 | + | NZ_CP026364.1 | Proteus hauseri |
| 74 | 2496611 | 2496814 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 75 | 3584119 | 3584322 | + | NZ_CP044060.1 | Aeromonas veronii |
| 76 | 3830900 | 3831106 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 77 | 306503 | 306706 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 78 | 368292 | 368498 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 79 | 347559 | 347765 | + | NZ_AP022188.1 | Aeromonas media |
| 80 | 1000030 | 1000233 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 81 | 2286346 | 2286585 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 82 | 299559 | 299765 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 83 | 1796727 | 1796930 | + | NZ_CP046378.1 | Shewanella algae |
| 84 | 67050 | 67253 | - | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| 85 | 1725392 | 1725592 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| 86 | 3854334 | 3854540 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 87 | 1591299 | 1591532 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 88 | 3573866 | 3574072 | - | NZ_CP040449.1 | Aeromonas simiae |
| 89 | 1804799 | 1805002 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 90 | 5005239 | 5005472 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 91 | 2204318 | 2204554 | + | NZ_CP007445.1 | Gilliamella apicola |
| 92 | 1573120 | 1573323 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 93 | 1885985 | 1886188 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 94 | 1776067 | 1776270 | - | NZ_CP024727.1 | Prevotella intermedia |
| 95 | 810192 | 810392 | - | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 96 | 1073792 | 1073992 | + | NZ_CP023863.1 | Prevotella jejuni |
| 97 | 634571 | 634771 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP038469.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 0.63 | 60 | 1660 | opposite-strand | Major Facilitator Superfamily |
++ More..