Result : P46879
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YqgD |
| NCBI Accession ID | U28377.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 40794 |
| Right | 41045 |
| Strand | - |
| Nucleotide Sequence | GTGGTAGCGGATCCTACCACGACTCTGCAGGTTAAAAACACTGGCAGTCTGAGTGTTAATCGGTATGGATGGATTAACATCTGGATGGCTATTTTAGGTCAATTCTTCACCCTATTTCCACTTTTTTTTGAATCGTGTCTCATTCTGTTAAAAACGTGGCTGGAAATTTTTCCTGACAATGCCGGCATTCTGCGTATTTATCTTTTGCAATTTTCTGCCATTGTGGGGTATAAAACGCGGCGCGCGGCTTAA |
| Sequence | MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDNAGILRIYLLQFSAIVGYKTRRAA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P46879 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3086399 | 3086650 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 704828 | 705079 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 3024688 | 3024939 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3828012 | 3828263 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3027424 | 3027675 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1975415 | 1975669 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3840010 | 3840216 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 8 | 3383408 | 3383614 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 9 | 3911116 | 3911322 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 10 | 839931 | 840176 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 11 | 50715 | 50927 | + | NZ_CP011602.1 | Phytobacter ursingii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00491.23 | 0.7 | 7 | 3098.5 | same-strand | Arginase family |
| 2 | PF02784.18 | 1.0 | 10 | 488 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 3 | PF17810.3 | 1.0 | 10 | 488 | same-strand | Arginine decarboxylase helical bundle domain |
| 4 | PF17944.3 | 1.0 | 10 | 488 | same-strand | Arginine decarboxylase C-terminal helical extension |
| 5 | PF02773.18 | 1.0 | 10 | 56 | opposite-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 6 | PF02772.18 | 1.0 | 10 | 56 | opposite-strand | S-adenosylmethionine synthetase, central domain |
| 7 | PF00438.22 | 1.0 | 10 | 56 | opposite-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 8 | PF00083.26 | 1.0 | 10 | 1647 | opposite-strand | Sugar (and other) transporter |
| 9 | PF10263.11 | 0.7 | 7 | 3160.0 | opposite-strand | SprT-like family |
| 10 | PF17283.4 | 0.9 | 9 | 3160.0 | opposite-strand | SprT-like zinc ribbon domain |
| 11 | PF04231.15 | 0.9 | 9 | 3710.0 | opposite-strand | Endonuclease I |
| 12 | PF04452.16 | 0.8 | 8 | 4497 | opposite-strand | RNA methyltransferase |
++ More..