Result : P46857
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrhB |
| NCBI Accession ID | U18997.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 365496 |
| Right | 365780 |
| Strand | + |
| Nucleotide Sequence | ATGATTACTTATCACGACGCATTCGCGAAAGCGAACCATTACCTTGATGATGCAGATCTCCCGGTCGTCATTACTCTACATGGACGCTTTAGCCAGGGCTGGTATTTCTGTTTCGAAGCACGAGAATTTCTCGAAACTGGAGATGAGGCCGCGCGCTTAGCTGGTAACGCACCTTTTATTATTGATAAAGACAGTGGTGAAATTCATTCTCTGGGAACGGCAAAACCGCTGGAAGAATATCTACAGGATTACGAAATAAAAAAGGCTACCTTCGGCTTGCCCTGA |
| Sequence | MITYHDAFAKANHYLDDADLPVVITLHGRFSQGWYFCFEAREFLETGDEAARLAGNAPFIIDKDSGEIHSLGTAKPLEEYLQDYEIKKATFGLP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam15567. Profile Description: Immunity protein 35. A predicted immunity protein with an alpha+beta fold and a conserved tryptophan residue. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, usually containing a protease domain such as Tox-PL1 and Ntox40. In some instances, it is also fused to a papain-like toxin, ADP-ribosyl glycohydrolase and a S8-like peptidase. Based on these associations the domain is likely to be a protease inhibitor. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:379730 |
| Functional Category | Others |
| Uniprot ID | P46857 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3584759 | 3585043 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2367068 | 2367346 | + | NZ_CP033744.1 | Citrobacter freundii |
| 3 | 4384990 | 4385268 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 4 | 3568777 | 3569049 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 5 | 2594467 | 2594745 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 6 | 4035318 | 4035596 | - | NZ_CP038853.1 | Pantoea vagans |
| 7 | 3464826 | 3465110 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 8 | 55089 | 55325 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015750.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13332.8 | 0.62 | 5 | 1568 | same-strand | Hemagglutinin repeat |
++ More..