Result : P46797
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin |
| NCBI Accession ID | X82178.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1405 |
| Right | 1587 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGTAAGAGTTGACGCAGATGCCTGCATTGGATGTGGAGTTTGTGAGAATCTCTGTCCTGACGTTTTCCAGCTCGGTGACGATGGAAAGGCAAAGGTCCTCCAGCCCGAAACGGATCTTCCCTGTGCGAAGGACGCCGCTGACAGCTGTCCAACCGGAGCTATCAGCGTAGAAGAGTGA |
| Sequence | MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVEE |
| Source of smORF | Swiss-Prot |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| Pubmed ID | 8168477 10360571 8939753 8647119 |
| Domain | CDD:418523 |
| Functional Category | Metal-binding |
| Uniprot ID | P46797 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 106
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1518 | 1700 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 2 | 1617435 | 1617617 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 3 | 1809553 | 1809735 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 4 | 1869371 | 1869553 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 5 | 1449 | 1631 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 6 | 1780 | 1962 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 7 | 2135122 | 2135304 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 8 | 2169504 | 2169686 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 9 | 1453 | 1635 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 10 | 2187251 | 2187433 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 11 | 2039640 | 2039819 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 12 | 1517 | 1699 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 13 | 2014730 | 2014912 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 14 | 2164839 | 2165021 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 15 | 221282 | 221464 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 16 | 551349 | 551531 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 17 | 1707964 | 1708143 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 18 | 759905 | 760084 | - | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 19 | 1284112 | 1284294 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 20 | 1157977 | 1158159 | - | NC_014804.1 | Thermococcus barophilus MP |
| 21 | 128868 | 129047 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 22 | 2168959 | 2169138 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 23 | 2973915 | 2974094 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 24 | 2301792 | 2301971 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 25 | 277225 | 277407 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 26 | 503137 | 503319 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 27 | 1145664 | 1145843 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 28 | 997909 | 998091 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 29 | 1002722 | 1002913 | + | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 30 | 1252266 | 1252457 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 31 | 118199 | 118390 | + | NZ_CP015102.1 | Thermococcus pacificus |
| 32 | 1275111 | 1275302 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 33 | 355305 | 355496 | + | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 34 | 62003 | 62194 | - | NZ_CP014862.1 | Thermococcus profundus |
| 35 | 1490707 | 1490898 | + | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 36 | 841660 | 841851 | - | NZ_CP008887.1 | Thermococcus eurythermalis |
| 37 | 2580887 | 2581075 | + | NZ_CP020953.1 | Clostridium drakei |
| 38 | 1230673 | 1230876 | - | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 39 | 657558 | 657755 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 40 | 1170315 | 1170497 | - | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 41 | 1673017 | 1673205 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 42 | 1605882 | 1606070 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 43 | 1628364 | 1628567 | - | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 44 | 1190335 | 1190517 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 45 | 9371 | 9574 | - | NZ_LN999010.1 | Thermococcus chitonophagus |
| 46 | 1381109 | 1381312 | + | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 47 | 1743294 | 1743497 | - | NZ_CP007264.1 | Thermococcus nautili |
| 48 | 683904 | 684086 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 49 | 683251 | 683433 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 50 | 1564472 | 1564651 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 51 | 101254 | 101445 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 52 | 712999 | 713184 | - | NZ_CP011267.1 | Geoglobus ahangari |
| 53 | 1111317 | 1111502 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 54 | 184824 | 185012 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 55 | 104375 | 104563 | + | NZ_CP016786.1 | Clostridium isatidis |
| 56 | 131574 | 131762 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 57 | 3704084 | 3704272 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 58 | 807073 | 807252 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 59 | 3099057 | 3099245 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 60 | 924841 | 925023 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 61 | 363296 | 363487 | + | NC_008593.1 | Clostridium novyi NT |
| 62 | 1885369 | 1885557 | + | NZ_CP023671.1 | Clostridium septicum |
| 63 | 843896 | 844087 | + | NZ_CP040924.1 | Clostridium thermarum |
| 64 | 1560874 | 1561062 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 65 | 1579557 | 1579745 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 66 | 4659018 | 4659203 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 67 | 1720867 | 1721055 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 68 | 1724668 | 1724856 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 69 | 764440 | 764628 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 70 | 2439028 | 2439216 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 71 | 179771 | 179959 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 72 | 2959872 | 2960063 | - | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 73 | 1703611 | 1703799 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 74 | 1743357 | 1743545 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 75 | 1570681 | 1570869 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 76 | 617711 | 617896 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 77 | 788081 | 788266 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 78 | 423260 | 423448 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 79 | 27211 | 27393 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 80 | 2383050 | 2383244 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 81 | 1039558 | 1039734 | - | NC_013665.1 | Methanocella paludicola SANAE |
| 82 | 3825369 | 3825557 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 83 | 1343691 | 1343870 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 84 | 3504881 | 3505069 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 85 | 3238426 | 3238617 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 86 | 4252977 | 4253168 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 87 | 1043290 | 1043478 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 88 | 1824311 | 1824499 | + | NC_017034.1 | Methanocella conradii HZ254 |
| 89 | 2787207 | 2787395 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 90 | 1169066 | 1169257 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 91 | 4013295 | 4013486 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 92 | 4144667 | 4144858 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 93 | 90176 | 90349 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 94 | 1446585 | 1446770 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 95 | 581617 | 581769 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 96 | 2915761 | 2915964 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 97 | 639621 | 639803 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 98 | 2409634 | 2409822 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 99 | 1035884 | 1036078 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 100 | 501459 | 501650 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 101 | 2504144 | 2504338 | + | NZ_CP016353.1 | Prauserella marina |
| 102 | 3397580 | 3397768 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 103 | 5737501 | 5737695 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 104 | 5181824 | 5182012 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 105 | 2630668 | 2630862 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 106 | 897180 | 897371 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 107 | 6825907 | 6826074 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 108 | 1979119 | 1979304 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 109 | 1351879 | 1352073 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
++ More..