Result : P46496
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Mu-like prophage FluMu DNA-binding protein Ner |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1560909 |
| Right | 1561178 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGTATTAGAAAAACCAAAAAAAACCGCAGAACAGGATTGGCACCGCGCCGATATTCTTGCGGAATTAAAAAAGAATGGTTGGTCGCTTCGCTCTTTAGCAAAAGAGGGGCAAGTCAGCTACAACACATTAAAAACAGTTTTGGATAAATCTTATCCAAAGATGGAGCGTTTAGTTGCAAATGCAATTGGTGTTCCACCTGAAGTTATCTGGGCTGGTCGTTTTGCTGAACGAAATAAAAGACCAACATTACAACATAAGTACTGA |
| Sequence | MSVLEKPKKTAEQDWHRADILAELKKNGWSLRSLAKEGQVSYNTLKTVLDKSYPKMERLVANAIGVPPEVIWAGRFAERNKRPTLQHKY |
| Source of smORF | Swiss-Prot |
| Function | Negative regulator of transcription starting from the Pe and Pc promoters of Mu. Also negatively regulates its own gene transcription (By similarity). {ECO:0000250}. |
| Pubmed ID | 7542800 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | P46496 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 50811 | 51089 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 2 | 113432 | 113695 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 3 | 663490 | 663768 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 4 | 227069 | 227287 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 5 | 2535648 | 2535908 | + | NZ_CP030241.1 | Moraxella bovis |
| 6 | 2056898 | 2057146 | - | NZ_CP031253.1 | Neisseria lactamica |
| 7 | 703836 | 704054 | - | NZ_LT906482.1 | Eikenella corrodens |
| 8 | 1426057 | 1426296 | + | NZ_LT906482.1 | Eikenella corrodens |
| 9 | 1114253 | 1114474 | - | NZ_LT906482.1 | Eikenella corrodens |
| 10 | 154356 | 154628 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 11 | 724857 | 725096 | - | NZ_CP038018.1 | Eikenella exigua |
| 12 | 1721463 | 1721750 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 13 | 334411 | 334662 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 14 | 14779 | 15030 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 15 | 884879 | 885100 | - | NZ_CP032487.1 | Yersinia hibernica |
| 16 | 1256755 | 1256976 | + | NZ_CP046293.1 | Yersinia intermedia |
| 17 | 4645373 | 4645675 | + | NC_010170.1 | Bordetella petrii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007715.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00717.25 | 0.62 | 8 | 221.5 | opposite-strand | Peptidase S24-like |
| 2 | PF13401.8 | 0.62 | 8 | 2266.5 | same-strand | AAA domain |
| 3 | PF09299.13 | 0.69 | 9 | 44.5 | same-strand | Mu transposase, C-terminal |
++ More..