Result : P46455
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0974.1 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1032765 |
| Right | 1033022 |
| Strand | + |
| Nucleotide Sequence | ATGACATTAAAACAACGTTATCAACAAGCTGGTAAAGAAGCCAGTTGGGCATTGAGCCTATCTATTTTATATGTGATAGGTTGGTGCTTATGTGCTTATTTGCCTAAAGAAACTCAAGGCCCTATCGGCTTTCCCCTCTGGTTTGAACTCTCTTGTATTTATTTGCCTATTCTGTTTATTGTAATTGGTCATTGGATTATCAAAATTATTTTTCAGGATATTTCTCTTGAAATTAACGATCAGGGGAATCAAAAATGA |
| Sequence | MTLKQRYQQAGKEASWALSLSILYVIGWCLCAYLPKETQGPIGFPLWFELSCIYLPILFIVIGHWIIKIIFQDISLEINDQGNQK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01614. Profile Description: Protein of unknown function (DUF997). hypothetical protein; Provisional |
| Pubmed ID | 7542800 |
| Domain | CDD:412986 |
| Functional Category | Others |
| Uniprot ID | P46455 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 25724 | 25981 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 708344 | 708601 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 3 | 24342 | 24599 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 4 | 1829096 | 1829359 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 879863 | 880132 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 2297689 | 2297964 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 7 | 828252 | 828527 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 8 | 1395994 | 1396272 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 9 | 1782384 | 1782662 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 10 | 47959 | 48231 | - | NZ_LR134167.1 | Avibacterium volantium |
| 11 | 820657 | 820893 | - | NZ_CP018804.1 | Histophilus somni |
| 12 | 1307452 | 1307706 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 13 | 1848145 | 1848402 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 14 | 389845 | 390096 | - | NZ_CP028926.1 | Pasteurella multocida |
| 15 | 1614804 | 1615046 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 16 | 3072585 | 3072827 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 17 | 3551285 | 3551527 | + | NZ_LS483422.1 | Providencia heimbachae |
| 18 | 1516058 | 1516300 | - | NZ_CP029736.1 | Providencia rettgeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483458.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06325.15 | 0.89 | 16 | 1612.5 | same-strand | Ribosomal protein L11 methyltransferase (PrmA) |
| 2 | PF00474.19 | 1.0 | 18 | -3.0 | same-strand | Sodium:solute symporter family |
| 3 | PF02786.19 | 0.89 | 16 | 177.0 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 4 | PF00289.24 | 0.89 | 16 | 177.0 | same-strand | Biotin carboxylase, N-terminal domain |
| 5 | PF02785.21 | 0.89 | 16 | 177.0 | same-strand | Biotin carboxylase C-terminal domain |
| 6 | PF02655.16 | 0.89 | 16 | 177.0 | same-strand | ATP-grasp domain |
| 7 | PF02222.24 | 0.89 | 16 | 177.0 | same-strand | ATP-grasp domain |
| 8 | PF00364.24 | 0.89 | 16 | 1536.0 | same-strand | Biotin-requiring enzyme |
| 9 | PF01220.21 | 0.83 | 15 | 2129 | same-strand | Dehydroquinase class II |
| 10 | PF02954.21 | 0.83 | 15 | 3757 | same-strand | Bacterial regulatory protein, Fis family |
| 11 | PF01207.19 | 0.83 | 15 | 2870 | same-strand | Dihydrouridine synthase (Dus) |
++ More..