Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_0974.1 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1032765 |
Right | 1033022 |
Strand | + |
Nucleotide Sequence | ATGACATTAAAACAACGTTATCAACAAGCTGGTAAAGAAGCCAGTTGGGCATTGAGCCTATCTATTTTATATGTGATAGGTTGGTGCTTATGTGCTTATTTGCCTAAAGAAACTCAAGGCCCTATCGGCTTTCCCCTCTGGTTTGAACTCTCTTGTATTTATTTGCCTATTCTGTTTATTGTAATTGGTCATTGGATTATCAAAATTATTTTTCAGGATATTTCTCTTGAAATTAACGATCAGGGGAATCAAAAATGA |
Sequence | MTLKQRYQQAGKEASWALSLSILYVIGWCLCAYLPKETQGPIGFPLWFELSCIYLPILFIVIGHWIIKIIFQDISLEINDQGNQK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01614. Profile Description: Protein of unknown function (DUF997). hypothetical protein; Provisional |
Pubmed ID | 7542800 |
Domain | CDD:412986 |
Functional Category | Others |
Uniprot ID | P46455 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 25724 | 25981 | - | NZ_LS483429.1 | Haemophilus aegyptius |
2 | 708344 | 708601 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
3 | 24342 | 24599 | - | NZ_CP009610.1 | Haemophilus influenzae |
4 | 1829096 | 1829359 | - | NZ_CP040863.1 | Rodentibacter heylii |
5 | 879863 | 880132 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
6 | 2297689 | 2297964 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
7 | 828252 | 828527 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
8 | 1395994 | 1396272 | - | NZ_CP015031.1 | Basfia succiniciproducens |
9 | 1782384 | 1782662 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
10 | 47959 | 48231 | - | NZ_LR134167.1 | Avibacterium volantium |
11 | 820657 | 820893 | - | NZ_CP018804.1 | Histophilus somni |
12 | 1307452 | 1307706 | - | NZ_LT906448.1 | Pasteurella dagmatis |
13 | 1848145 | 1848402 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
14 | 389845 | 390096 | - | NZ_CP028926.1 | Pasteurella multocida |
15 | 1614804 | 1615046 | - | NZ_CP023536.1 | Providencia alcalifaciens |
16 | 3072585 | 3072827 | + | NZ_CP031123.2 | Providencia huaxiensis |
17 | 3551285 | 3551527 | + | NZ_LS483422.1 | Providencia heimbachae |
18 | 1516058 | 1516300 | - | NZ_CP029736.1 | Providencia rettgeri |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06325.15 | 0.89 | 16 | 1612.5 | same-strand | Ribosomal protein L11 methyltransferase (PrmA) |
2 | PF00474.19 | 1.0 | 18 | -3.0 | same-strand | Sodium:solute symporter family |
3 | PF02786.19 | 0.89 | 16 | 177.0 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
4 | PF00289.24 | 0.89 | 16 | 177.0 | same-strand | Biotin carboxylase, N-terminal domain |
5 | PF02785.21 | 0.89 | 16 | 177.0 | same-strand | Biotin carboxylase C-terminal domain |
6 | PF02655.16 | 0.89 | 16 | 177.0 | same-strand | ATP-grasp domain |
7 | PF02222.24 | 0.89 | 16 | 177.0 | same-strand | ATP-grasp domain |
8 | PF00364.24 | 0.89 | 16 | 1536.0 | same-strand | Biotin-requiring enzyme |
9 | PF01220.21 | 0.83 | 15 | 2129 | same-strand | Dehydroquinase class II |
10 | PF02954.21 | 0.83 | 15 | 3757 | same-strand | Bacterial regulatory protein, Fis family |
11 | PF01207.19 | 0.83 | 15 | 2870 | same-strand | Dihydrouridine synthase (Dus) |