Result : P46332
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YxcA |
| NCBI Accession ID | AB005554.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 27351 |
| Right | 27602 |
| Strand | + |
| Nucleotide Sequence | TTGAAGGTACAGCATAAGAAGGAGCTCAAGTTTTATTGCATCGTGACCATTCCATCTGCATTTGTTGTGCTGACTGTCATCTCTTTTTTATTGCAAGAGATTACGTTCCCGGTGACTGCAAGCGCATTTCTGAATGCTTCATGGCATAATCTTTTGTTTTTGATACCGTTCGGTTTGTTTTTCTACCCGGTGCATATATGGATGAAGCGGGAGTTTGGCCGTTGGAATGACACAGAAAAAAAGAGAGGATGA |
| Sequence | MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLFFYPVHIWMKREFGRWNDTEKKRG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7584049 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P46332 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4091477 | 4091728 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3991717 | 3991968 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3900294 | 3900545 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 18174 | 18428 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3910446 | 3910697 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2146905 | 2147156 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 126938 | 127186 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 3907225 | 3907473 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00248.23 | 0.62 | 5 | 4554 | opposite-strand | Aldo/keto reductase family |
| 2 | PF00083.26 | 1.0 | 8 | 2096.0 | opposite-strand | Sugar (and other) transporter |
| 3 | PF07690.18 | 1.0 | 8 | 2096.0 | opposite-strand | Major Facilitator Superfamily |
| 4 | PF00183.20 | 1.0 | 8 | 174.0 | same-strand | Hsp90 protein |
| 5 | PF02518.28 | 0.88 | 7 | 176 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF13561.8 | 1.0 | 8 | 118.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 7 | PF00106.27 | 1.0 | 8 | 118.0 | opposite-strand | short chain dehydrogenase |
| 8 | PF08659.12 | 1.0 | 8 | 118.0 | opposite-strand | KR domain |
| 9 | PF00440.25 | 1.0 | 8 | 1299.0 | same-strand | Bacterial regulatory proteins, tetR family |
| 10 | PF14278.8 | 1.0 | 8 | 1299.0 | same-strand | Transcriptional regulator C-terminal region |
| 11 | PF00171.24 | 1.0 | 8 | 2591.5 | opposite-strand | Aldehyde dehydrogenase family |
++ More..