Result : P46119

Protein Information

• Protein name: Uncharacterized protein YbjC
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 890913
• Right: 891200
• Strand: +
• Nucleotide Sequence: ATGCGCGCGATCGGTAAATTGCCTAAAGGCGTGTTGATACTGGAATTTATCGGAATGATGCTACTGGCGGTGGCGCTGCTGTCGGTAAGCGACTCCCTGTCGCTGCCTGAGCCATTTTCTCGGCCAGAAGTGCAGATTCTGATGATTTTTCTCGGTGTTTTGCTCATGCTTCCCGCTGCGGTGGTGGTTATTCTTCAGGTGGCAAAACGTCTTGCCCCACAGCTGATGAACCGTCCACCGCAATATTCACGTTCAGAAAGAGAAAAAGATAATGACGCCAACCATTGA
• Sequence: MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQILMIFLGVLLMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDNDANH
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl11648. Profile Description: Protein of unknown function (DUF1418). hypothetical protein; Provisional
• Pubmed ID: 8905232 9278503 16738553 3530878 7567469
• Domain: CDD:386195
• Functional Category: Others
• Uniprot ID: P46119
• ORF Length (Amino Acid): 95

Conservation Analysis

No. of Species: 18

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	890913	891200	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	1016201	1016488	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
3	836330	836617	+	NC_004337.2	Shigella flexneri 2a str. 301
4	2920195	2920482	+	NZ_CP061527.1	Shigella dysenteriae
5	1540258	1540545	+	NZ_LR134340.1	Escherichia marmotae
6	916144	916431	+	NZ_AP014857.1	Escherichia albertii
7	3946909	3947196	-	NZ_CP045205.1	Citrobacter telavivensis
8	945510	945800	+	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
9	3733328	3733615	-	NZ_CP046672.1	Raoultella ornithinolytica
10	3565674	3565961	-	NZ_CP041247.1	Raoultella electrica
11	1797198	1797488	-	NZ_CP038469.1	Citrobacter tructae
12	3418687	3418977	+	NZ_CP053416.1	Salmonella bongori
13	4423483	4423773	+	NZ_CP033744.1	Citrobacter freundii
14	2092672	2092962	-	NC_009792.1	Citrobacter koseri ATCC BAA-895
15	3937536	3937826	-	NZ_CP036175.1	Klebsiella huaxiensis
16	4105840	4106130	-	NZ_CP060111.1	Klebsiella michiganensis
17	1611130	1611420	+	NZ_CP012871.1	[Enterobacter] lignolyticus
18	692125	692415	-	NZ_CP044098.1	Citrobacter portucalensis
19	3151785	3152015	+	NZ_LT556085.1	Citrobacter amalonaticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17940.3	0.67	12	2968	same-strand	Tetracyclin repressor-like, C-terminal domain
2	PF00440.25	0.67	12	2968	same-strand	Bacterial regulatory proteins, tetR family
3	PF06826.14	1.0	18	1114	opposite-strand	Predicted Permease Membrane Region
4	PF02080.23	1.0	18	1114	opposite-strand	TrkA-C domain
5	PF11045.10	0.89	16	465	same-strand	Putative inner membrane protein of Enterobacteriaceae
6	PF00462.26	1.0	18	173	opposite-strand	Glutaredoxin
7	PF00881.26	1.0	18	-16	same-strand	Nitroreductase family
8	PF08443.13	1.0	18	767	same-strand	RimK-like ATP-grasp domain
9	PF18030.3	0.94	17	767.0	same-strand	RimK PreATP-grasp domain
10	PF02955.18	1.0	18	767	same-strand	Prokaryotic glutathione synthetase, ATP-grasp domain
11	PF02655.16	1.0	18	767	same-strand	ATP-grasp domain
12	PF10722.11	1.0	18	1760	same-strand	Putative bacterial sensory transduction regulator
13	PF13416.8	1.0	18	2630	same-strand	Bacterial extracellular solute-binding protein
14	PF13343.8	1.0	18	2630	same-strand	Bacterial extracellular solute-binding protein
15	PF01547.27	1.0	18	2630	same-strand	Bacterial extracellular solute-binding protein
16	PF13531.8	1.0	18	2630	same-strand	Bacterial extracellular solute-binding protein
17	PF00005.29	0.94	17	3811.0	same-strand	ABC transporter
18	PF08402.12	0.94	17	3811.0	same-strand	TOBE domain