Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YbjC |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 890913 |
Right | 891200 |
Strand | + |
Nucleotide Sequence | ATGCGCGCGATCGGTAAATTGCCTAAAGGCGTGTTGATACTGGAATTTATCGGAATGATGCTACTGGCGGTGGCGCTGCTGTCGGTAAGCGACTCCCTGTCGCTGCCTGAGCCATTTTCTCGGCCAGAAGTGCAGATTCTGATGATTTTTCTCGGTGTTTTGCTCATGCTTCCCGCTGCGGTGGTGGTTATTCTTCAGGTGGCAAAACGTCTTGCCCCACAGCTGATGAACCGTCCACCGCAATATTCACGTTCAGAAAGAGAAAAAGATAATGACGCCAACCATTGA |
Sequence | MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQILMIFLGVLLMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDNDANH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl11648. Profile Description: Protein of unknown function (DUF1418). hypothetical protein; Provisional |
Pubmed ID | 8905232 9278503 16738553 3530878 7567469 |
Domain | CDD:386195 |
Functional Category | Others |
Uniprot ID | P46119 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 890913 | 891200 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1016201 | 1016488 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 836330 | 836617 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 2920195 | 2920482 | + | NZ_CP061527.1 | Shigella dysenteriae |
5 | 1540258 | 1540545 | + | NZ_LR134340.1 | Escherichia marmotae |
6 | 916144 | 916431 | + | NZ_AP014857.1 | Escherichia albertii |
7 | 3946909 | 3947196 | - | NZ_CP045205.1 | Citrobacter telavivensis |
8 | 945510 | 945800 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
9 | 3733328 | 3733615 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
10 | 3565674 | 3565961 | - | NZ_CP041247.1 | Raoultella electrica |
11 | 1797198 | 1797488 | - | NZ_CP038469.1 | Citrobacter tructae |
12 | 3418687 | 3418977 | + | NZ_CP053416.1 | Salmonella bongori |
13 | 4423483 | 4423773 | + | NZ_CP033744.1 | Citrobacter freundii |
14 | 2092672 | 2092962 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
15 | 3937536 | 3937826 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
16 | 4105840 | 4106130 | - | NZ_CP060111.1 | Klebsiella michiganensis |
17 | 1611130 | 1611420 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
18 | 692125 | 692415 | - | NZ_CP044098.1 | Citrobacter portucalensis |
19 | 3151785 | 3152015 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17940.3 | 0.67 | 12 | 2968 | same-strand | Tetracyclin repressor-like, C-terminal domain |
2 | PF00440.25 | 0.67 | 12 | 2968 | same-strand | Bacterial regulatory proteins, tetR family |
3 | PF06826.14 | 1.0 | 18 | 1114 | opposite-strand | Predicted Permease Membrane Region |
4 | PF02080.23 | 1.0 | 18 | 1114 | opposite-strand | TrkA-C domain |
5 | PF11045.10 | 0.89 | 16 | 465 | same-strand | Putative inner membrane protein of Enterobacteriaceae |
6 | PF00462.26 | 1.0 | 18 | 173 | opposite-strand | Glutaredoxin |
7 | PF00881.26 | 1.0 | 18 | -16 | same-strand | Nitroreductase family |
8 | PF08443.13 | 1.0 | 18 | 767 | same-strand | RimK-like ATP-grasp domain |
9 | PF18030.3 | 0.94 | 17 | 767.0 | same-strand | RimK PreATP-grasp domain |
10 | PF02955.18 | 1.0 | 18 | 767 | same-strand | Prokaryotic glutathione synthetase, ATP-grasp domain |
11 | PF02655.16 | 1.0 | 18 | 767 | same-strand | ATP-grasp domain |
12 | PF10722.11 | 1.0 | 18 | 1760 | same-strand | Putative bacterial sensory transduction regulator |
13 | PF13416.8 | 1.0 | 18 | 2630 | same-strand | Bacterial extracellular solute-binding protein |
14 | PF13343.8 | 1.0 | 18 | 2630 | same-strand | Bacterial extracellular solute-binding protein |
15 | PF01547.27 | 1.0 | 18 | 2630 | same-strand | Bacterial extracellular solute-binding protein |
16 | PF13531.8 | 1.0 | 18 | 2630 | same-strand | Bacterial extracellular solute-binding protein |
17 | PF00005.29 | 0.94 | 17 | 3811.0 | same-strand | ABC transporter |
18 | PF08402.12 | 0.94 | 17 | 3811.0 | same-strand | TOBE domain |