ProsmORF-pred
Result : P46047
Protein Information
Information Type Description
Protein name Ferredoxin, vegetative
NCBI Accession ID Z46890.1
Organism Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis)
Left 1346
Right 1645
Strand +
Nucleotide Sequence ATGACCACTTATCAAGTGAGATTGATTAATAAAAAGAGAGCGATCGACATTACTATTCCTGTTGACGAAAATACCACAATTCTAGATGCCGCAGAACAACAAGACATAGAGTTACCCTTTTCCTGTCAATCTGGGTCTTGCTCTAGTTGCGTTGCTAAAGTGGTTGAGGGTGAAGTTGATCAGTCCGAACAAGTATTTCTCGATGAAGAGCAAATGGCTAAAGGATTTATTGTCCTGTGTGTCTCCTATCCCCGTTCTGACTGCACAATTCGCACTCATCAAGAACCCTATTTAGTTTGA
Sequence MTTYQVRLINKKRAIDITIPVDENTTILDAAEQQDIELPFSCQSGSCSSCVAKVVEGEVDQSEQVFLDEEQMAKGFIVLCVSYPRSDCTIRTHQEPYLV
Source of smORF Swiss-Prot
Function Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. Donates electrons to the nitrogenase 2.
Pubmed ID 8709854 25197444
Domain CDD:412190
Functional Category Metal-binding
Uniprot ID P46047
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 30
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 271546 271845 + NZ_CP047242.1 Trichormus variabilis 0441
2 6204703 6205002 + NZ_CP047242.1 Trichormus variabilis 0441
3 3165120 3165440 - NZ_CP047242.1 Trichormus variabilis 0441
4 2225048 2225347 + NZ_CP047242.1 Trichormus variabilis 0441
5 2496571 2496870 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
6 4496764 4497063 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
7 5171767 5172066 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
8 3555906 3556205 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
9 2435667 2436008 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
10 1416500 1416799 - NC_014248.1 'Nostoc azollae' 0708
11 478670 478969 - NC_010628.1 Nostoc punctiforme PCC 73102
12 4855071 4855370 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
13 4628959 4629258 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
14 3332367 3332714 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
15 1010928 1011227 - NZ_CP031941.1 Nostoc sphaeroides
16 3665126 3665425 - NZ_CP031941.1 Nostoc sphaeroides
17 1603752 1604105 - NZ_CP031941.1 Nostoc sphaeroides
18 5143811 5144110 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
19 3188289 3188588 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
20 248118 248417 + NC_019751.1 Calothrix sp. PCC 6303
21 1010152 1010451 - NC_019751.1 Calothrix sp. PCC 6303
22 4086921 4087232 + NC_014501.1 Gloeothece verrucosa PCC 7822
23 2071507 2071806 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
24 2361515 2361772 - NC_011729.1 Gloeothece citriformis PCC 7424
25 1978588 1978887 + NC_011729.1 Gloeothece citriformis PCC 7424
26 1195450 1195749 - NC_011729.1 Gloeothece citriformis PCC 7424
27 5501312 5501611 + NC_009925.1 Acaryochloris marina MBIC11017
28 5204259 5204600 - NC_009925.1 Acaryochloris marina MBIC11017
29 5563740 5564039 + NC_009925.1 Acaryochloris marina MBIC11017
30 2514067 2514342 + NC_019771.1 Anabaena cylindrica PCC 7122
31 2706493 2706819 - NC_019771.1 Anabaena cylindrica PCC 7122
32 147098 147397 - NC_019753.1 Crinalium epipsammum PCC 9333
33 1510228 1510566 - NC_019753.1 Crinalium epipsammum PCC 9333
34 5759341 5759640 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
35 4660020 4660340 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
36 5652597 5652896 + NC_019693.1 Oscillatoria acuminata PCC 6304
37 1820817 1821116 - NZ_CP021983.2 Halomicronema hongdechloris C2206
38 475641 475955 + NZ_CP042326.1 Euhalothece natronophila Z-M001
39 3055772 3056071 - NC_019675.1 Cyanobium gracile PCC 6307
40 474740 475033 + NZ_CP018092.1 Synechococcus lividus PCC 6715
41 3779622 3779936 + NC_019689.1 Pleurocapsa sp. PCC 7327
42 4905170 4905463 - NC_019689.1 Pleurocapsa sp. PCC 7327
43 1657107 1657406 + NC_019780.1 Dactylococcopsis salina PCC 8305
44 902650 902946 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
45 1034109 1034405 - NC_004113.1 Thermosynechococcus vestitus BP-1
46 2901659 2901952 - NC_019776.1 Cyanobacterium aponinum PCC 10605
47 2408470 2408763 + NC_022600.1 Gloeobacter kilaueensis JS1
48 3297932 3298228 + NC_010296.1 Microcystis aeruginosa NIES-843
49 3252668 3252961 - NC_019748.1 Stanieria cyanosphaera PCC 7437
50 697044 697286 + NZ_CP020919.1 Flavobacterium kingsejongi
++ More..