| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0437 protein in nifX-nifW intergenic region (ORF1) |
| NCBI Accession ID | L29299.1 |
| Organism | Frankia alni |
| Left | 918 |
| Right | 1166 |
| Strand | + |
| Nucleotide Sequence | ATGACTCCTGAGCCGCCAGCCCCGGACACCGCGAGCCGCGACGCCGAGAACCTCGACGCCGCCGCCGCCCAGCAGCGGCTGCGCAAGCTCCACAGCAAGGCCACCCGACTCAAGCTTGATCTTCACGACCTCGCCGAGGACCTCCCGATCGGCTGGGAGGGCCTGCTCGACGTCGCCCGCCGGACCTATGACGCCTATGCCGAGATCGCCCTGTTGGAGGGCCTGGCCGAGAAGGAGACGTCGCGATGA |
| Sequence | MTPEPPAPDTASRDAENLDAAAAQQRLRKLHSKATRLKLDLHDLAEDLPIGWEGLLDVARRTYDAYAEIALLEGLAEKETSR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02247. Profile Description: Rop-like. This family contains several uncharacterized bacterial proteins. These proteins are found in nitrogen fixation operons so are likely to play some role in this process. They consist of two alpha helices which are joined by a four residue linker. The helices form an antiparallel bundle and cross towards their termini. They are likely to form a rod-like dimer. They have structural similarity to the regulatory protein Rop, pfam01815. |
| Pubmed ID | 7642138 |
| Domain | CDD:413246 |
| Functional Category | Others |
| Uniprot ID | P46041 |
| ORF Length (Amino Acid) | 82 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 7412908 | 7413141 | - | NC_008278.1 | Frankia alni ACN14a |
| 2 | 5352184 | 5352450 | - | NC_007777.1 | Frankia casuarinae |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00899.23 | 1.0 | 2 | 3155.0 | same-strand | ThiF family |
| 2 | PF01521.22 | 1.0 | 2 | 2481.0 | same-strand | Iron-sulphur cluster biosynthesis |
| 3 | PF01106.19 | 1.0 | 2 | 2481.0 | same-strand | NifU-like domain |
| 4 | PF04055.23 | 1.0 | 2 | 920.5 | same-strand | Radical SAM superfamily |
| 5 | PF02579.19 | 1.0 | 2 | 617.5 | same-strand | Dinitrogenase iron-molybdenum cofactor |
| 6 | PF04319.15 | 1.0 | 2 | 419.0 | same-strand | NifZ domain |
| 7 | PF03206.16 | 1.0 | 2 | -3.0 | same-strand | Nitrogen fixation protein NifW |
| 8 | PF03270.15 | 1.0 | 2 | -10.0 | same-strand | Protein of unknown function, DUF269 |
| 9 | PF00148.21 | 1.0 | 2 | 2618.0 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 10 | PF11844.10 | 1.0 | 2 | 4198.5 | same-strand | Domain of unknown function (DUF3364) |