Result : P45912
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqaO |
| NCBI Accession ID | D32216.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8516 |
| Right | 8722 |
| Strand | + |
| Nucleotide Sequence | GTGTACAATCCAAGAGAAATAAACATCAAAAAAGACTTCACTATTCAGCAGAAAATTGACCCAGGAAAAGTTCAGATCATTGTTTTAGATGGGAATCAGGGAACTGCACATGTTTTAGATGCTCCGGAGCACGGCAAAACAGTGATTCAAACTGTAAAGGGCAGCTTTGCAAGGGTTGATCATGAGATAGGGTTTAAGGTGAAATGA |
| Sequence | MYNPREINIKKDFTIQQKIDPGKVQIIVLDGNQGTAHVLDAPEHGKTVIQTVKGSFARVDHEIGFKVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17356. Profile Description: Phage-like element PBSX protein XtrA. This is a family of unknown function found in Bacilli. |
| Pubmed ID | 7704261 8969508 9384377 7489895 |
| Domain | CDD:407452 |
| Functional Category | Others |
| Uniprot ID | P45912 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2692645 | 2692851 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2547658 | 2547864 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3079586 | 3079792 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2198233 | 2198436 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 3176967 | 3177170 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 6 | 3326340 | 3326543 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 1026656 | 1026859 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 8 | 2588366 | 2588596 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 9 | 3234266 | 3234472 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 2816383 | 2816589 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 2493482 | 2493688 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 1434026 | 1434238 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 1321960 | 1322163 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1423880 | 1424083 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017786.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04466.15 | 0.6 | 6 | 1504.0 | same-strand | Phage terminase large subunit |
| 2 | PF17288.4 | 0.6 | 6 | 1504.0 | same-strand | Terminase RNAseH like domain |
| 3 | PF03237.17 | 0.6 | 6 | 1504.0 | same-strand | Terminase large subunit, T4likevirus-type, N-terminal |
| 4 | PF04545.18 | 0.6 | 6 | 123.0 | same-strand | Sigma-70, region 4 |
++ More..