Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YqaI |
NCBI Accession ID | D32216.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 4078 |
Right | 4272 |
Strand | + |
Nucleotide Sequence | ATGGTCGAAAATCCAATGGTCATAAACAACTGGCACGATAAGCTGACTGAAACGGATGTACAAATAGATTTTTACGGTGATGAAGTAACACCAGTTGATGATTATGTAATTGATGGCGGCGAAATCATTCTCAGAGAGAACTTGGAAAGGTATCTAAGGGAGCAACTTGGTTTTGAATTTAAAAACGCGCAATAA |
Sequence | MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam09466. Profile Description: Hypothetical protein Yqai. This hypothetical protein is expressed in bacteria, particularly Bacillus subtilis. It forms a homo-dimer, with each monomer containing an alpha helix and four beta strands. |
Pubmed ID | 7704261 8969508 9384377 7489895 |
Domain | CDD:312837 |
Functional Category | Others |
Uniprot ID | P45906 |
ORF Length (Amino Acid) | 64 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2697095 | 2697289 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3074380 | 3074574 | + | NZ_CP029364.1 | Bacillus halotolerans |
3 | 2203092 | 2203265 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07261.13 | 0.67 | 2 | 2068.0 | same-strand | Replication initiation and membrane attachment |
2 | PF17448.4 | 1.0 | 3 | 130 | same-strand | Uncharacterized YqaH-like |
3 | PF01381.24 | 1.0 | 3 | 384 | same-strand | Helix-turn-helix |
4 | PF12844.9 | 0.67 | 2 | 1786.5 | both-strands | Helix-turn-helix domain |
5 | PF09669.12 | 0.67 | 2 | 957.5 | same-strand | Phage regulatory protein Rha (Phage pRha) |
6 | PF03374.16 | 0.67 | 2 | 957.5 | same-strand | Phage antirepressor protein KilAC domain |
7 | PF12684.9 | 0.67 | 2 | 1220.5 | same-strand | PDDEXK-like domain of unknown function (DUF3799) |