Result : P45905

Protein Information

• Protein name: Uncharacterized protein YqaH
• NCBI Accession ID: D32216.1
• Organism: Bacillus subtilis (strain 168)
• Left: 3691
• Right: 3948
• Strand: +
• Nucleotide Sequence: ATGAATACTAATCATTTCTTGAAGGCAGATGTTCCTATCGCAAAAAGAAAAATCGAATCAGCAGAAGAGCTATCAATCATGCTGTCAGAGGCATTACGTGATGGTGATTATGAAGAAGCGATTAGTCTTGCTGGAAGCATCAAGGTTCTTACTGAGGATATTAGCCGGCTTGCAAACAAAGGACGCCTTTATGAAACGGCATTGAAAATGCAACAGCAAGGTATCAACTTAACTGTAGTGAGCAGGTGTATAGGATGA
• Sequence: MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAGSIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam17448. Profile Description: Uncharacterized protein YqaH. This is a family of unknown function found in Bacillus.
• Pubmed ID: 7704261 8969508 9384377 7489895
• Domain: CDD:340163
• Functional Category: Others
• Uniprot ID: P45905
• ORF Length (Amino Acid): 85

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2697419	2697676	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	3073993	3074250	+	NZ_CP029364.1	Bacillus halotolerans
3	2203286	2203543	-	NZ_CP053376.1	Bacillus amyloliquefaciens
4	3240172	3240378	-	NZ_LT603683.1	Bacillus glycinifermentans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF09466.12	0.75	3	130	same-strand	Hypothetical protein Yqai
2	PF01381.24	1.0	4	810	same-strand	Helix-turn-helix
3	PF12844.9	0.75	3	1570.5	opposite-strand	Helix-turn-helix domain
4	PF13560.8	0.75	3	1738.5	opposite-strand	Helix-turn-helix domain