| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqaH |
| NCBI Accession ID | D32216.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3691 |
| Right | 3948 |
| Strand | + |
| Nucleotide Sequence | ATGAATACTAATCATTTCTTGAAGGCAGATGTTCCTATCGCAAAAAGAAAAATCGAATCAGCAGAAGAGCTATCAATCATGCTGTCAGAGGCATTACGTGATGGTGATTATGAAGAAGCGATTAGTCTTGCTGGAAGCATCAAGGTTCTTACTGAGGATATTAGCCGGCTTGCAAACAAAGGACGCCTTTATGAAACGGCATTGAAAATGCAACAGCAAGGTATCAACTTAACTGTAGTGAGCAGGTGTATAGGATGA |
| Sequence | MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAGSIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17448. Profile Description: Uncharacterized protein YqaH. This is a family of unknown function found in Bacillus. |
| Pubmed ID | 7704261 8969508 9384377 7489895 |
| Domain | CDD:340163 |
| Functional Category | Others |
| Uniprot ID | P45905 |
| ORF Length (Amino Acid) | 85 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2697419 | 2697676 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3073993 | 3074250 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 2203286 | 2203543 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 4 | 3240172 | 3240378 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09466.12 | 0.75 | 3 | 130 | same-strand | Hypothetical protein Yqai |
| 2 | PF01381.24 | 1.0 | 4 | 810 | same-strand | Helix-turn-helix |
| 3 | PF12844.9 | 0.75 | 3 | 1570.5 | opposite-strand | Helix-turn-helix domain |
| 4 | PF13560.8 | 0.75 | 3 | 1738.5 | opposite-strand | Helix-turn-helix domain |