Result : P45903
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YqaF |
| NCBI Accession ID | D32216.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2651 |
| Right | 2881 |
| Strand | + |
| Nucleotide Sequence | ATGATGAGAAAATGGCTTAAGAAAAACCGCTTAGAAAAAGGGTTTACTCAAGAAGAAGTTGCCAAAGCTGCACAGATTGGTAGAGCATACTACACCATGATAGAAAATGGTACTAGGAAGCCTAGTGTTATTGTCTCAAAAAAAATAGGAGAGAAATTAGGCTTTGACTGGACTATTTTTTTTGAGGATGTATGTAACGAAACGAAACATAATTCTAAGGATTCAGCATGA |
| Sequence | MMRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIVSKKIGEKLGFDWTIFFEDVCNETKHNSKDSA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 7704261 8969508 9384377 7489895 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | P45903 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2698486 | 2698716 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2690319 | 2690543 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 3 | 36739 | 36963 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 4 | 2162460 | 2162696 | - | NZ_CP019401.1 | Planococcus faecalis |
| 5 | 2622426 | 2622650 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 6 | 2202594 | 2202815 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 7 | 3549383 | 3549571 | - | NZ_CP053989.1 | Niallia circulans |
| 8 | 1067191 | 1067406 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 9 | 1758058 | 1758285 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 10 | 1028843 | 1029070 | + | NZ_CP065211.1 | Enterococcus lactis |
| 11 | 1742838 | 1743056 | + | NZ_AP019400.1 | Cohnella abietis |
| 12 | 2136757 | 2136966 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 13 | 540553 | 540798 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 14 | 1723804 | 1724049 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 1585588 | 1585773 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 1.0 | 15 | 177 | opposite-strand | Helix-turn-helix |
| 2 | PF12844.9 | 0.93 | 14 | 174.0 | opposite-strand | Helix-turn-helix domain |
| 3 | PF13560.8 | 0.93 | 14 | 165.5 | opposite-strand | Helix-turn-helix domain |
++ More..