Result : P45874
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwkF |
| NCBI Accession ID | Z49782.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 25621 |
| Right | 25908 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAGGCCCTGACAGCAGGAATCCTGCTCATTGCGATTGAGAGCATGATTGGCACCATTTTTCCGCAGGCTCTTTCATATGAAGCGATTTTTGGCGTTGCGTCTCTCGTTTTAGTGGGGCTCGCGATCATTACATCGGGTTTGGCTGTAAGCGGAAGCGATCAGCGGGCAAACTACCATTCAGAAACCAAAGAAGGCCGTACATCTCGCATGAAAATGGCGGCCGCTTTCTTTGTTGCGGCGATACCTTCCATTCTATGTTATTTACTGACGATTTTGTTTTAA |
| Sequence | MKKALTAGILLIAIESMIGTIFPQALSYEAIFGVASLVLVGLAIITSGLAVSGSDQRANYHSETKEGRTSRMKMAAAFFVAAIPSILCYLLTILF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17247. Profile Description: Family of unknown function (DUF5316). This is a family of unknown function mainly found in Firmicutes. Might contain multiple trans-membrane sequences. |
| Pubmed ID | 9353933 9384377 |
| Domain | CDD:407362 |
| Functional Category | Others |
| Uniprot ID | P45874 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3795870 | 3796157 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3685101 | 3685388 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3668202 | 3668492 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3623005 | 3623289 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2442914 | 2443201 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3610298 | 3610585 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3628571 | 3628858 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3654689 | 3654967 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 391273 | 391506 | + | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02659.17 | 1.0 | 9 | 2982 | same-strand | Putative manganese efflux pump |
| 2 | PF01300.20 | 1.0 | 9 | 1864 | same-strand | Telomere recombination |
| 3 | PF03481.15 | 1.0 | 9 | 1864 | same-strand | Putative GTP-binding controlling metal-binding |
| 4 | PF13673.9 | 0.67 | 6 | 1254.5 | same-strand | Acetyltransferase (GNAT) domain |
| 5 | PF09551.12 | 1.0 | 9 | 522 | same-strand | Stage II sporulation protein R (spore II R) |
| 6 | PF17094.7 | 1.0 | 9 | 16 | opposite-strand | Uncharacterised protein family (UPF0715) |
| 7 | PF17827.3 | 1.0 | 9 | 62 | same-strand | PrmC N-terminal domain |
| 8 | PF13649.8 | 1.0 | 9 | 62 | same-strand | Methyltransferase domain |
| 9 | PF03462.20 | 1.0 | 9 | 930 | same-strand | PCRF domain |
| 10 | PF00472.22 | 1.0 | 9 | 930 | same-strand | RF-1 domain |
| 11 | PF00903.27 | 1.0 | 9 | 2129 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 12 | PF13669.8 | 1.0 | 9 | 2129 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 13 | PF13411.8 | 1.0 | 9 | 2634 | opposite-strand | MerR HTH family regulatory protein |
++ More..