Result : A5F8G9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | |
| Organism | Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MEKQCSKFIVSGHVQGVGFCYHTSHQGLKLGLTGYAKNLNNGDVEVVACGTPERLEELYLWLQEGPKTASVRQVRRLSSELEHDYQGFEIL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 19115014 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A5F8G9 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1295593 | 1295868 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 2 | 1026486 | 1026761 | + | NZ_CP035688.1 | Vibrio metoecus |
| 3 | 1503561 | 1503833 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 4 | 1536496 | 1536768 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 5 | 1348749 | 1349027 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 6 | 1985055 | 1985330 | + | NZ_CP040990.1 | Vibrio furnissii |
| 7 | 1369900 | 1370175 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 8 | 7780 | 8052 | + | NZ_CP019959.1 | Vibrio owensii |
| 9 | 1489508 | 1489780 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 10 | 1635302 | 1635574 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 11 | 2021071 | 2021343 | - | NZ_CP009467.1 | Vibrio harveyi |
| 12 | 397301 | 397573 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 13 | 1648711 | 1648983 | - | NZ_CP030788.1 | Vibrio campbellii |
| 14 | 1191951 | 1192223 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 15 | 1988795 | 1989067 | + | NC_013456.1 | Vibrio antiquarius |
| 16 | 1556231 | 1556503 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 17 | 1587352 | 1587624 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 18 | 1824268 | 1824546 | + | NZ_CP046268.1 | Vibrio spartinae |
| 19 | 516513 | 516785 | - | NZ_AP018690.1 | Vibrio aphrogenes |
| 20 | 1206632 | 1206904 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 21 | 2631414 | 2631686 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 22 | 1839843 | 1840079 | - | NZ_AP014635.1 | Vibrio tritonius |
| 23 | 695258 | 695491 | - | NZ_AP018686.1 | Vibrio rumoiensis |
| 24 | 1352773 | 1353045 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 25 | 310542 | 310790 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 26 | 1219864 | 1220136 | + | NZ_AP019657.1 | Vibrio ponticus |
| 27 | 769134 | 769406 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 28 | 1468073 | 1468345 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 29 | 2110982 | 2111254 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 30 | 3217235 | 3217468 | - | NZ_CP023525.1 | Cedecea neteri |
| 31 | 4219586 | 4219864 | - | NZ_CP019706.1 | Pantoea alhagi |
| 32 | 2578162 | 2578386 | - | NZ_CP038254.1 | Legionella israelensis |
| 33 | 1710380 | 1710658 | + | NZ_CP026377.1 | Mixta gaviniae |
| 34 | 877914 | 878192 | + | NZ_CP028271.1 | Mixta intestinalis |
| 35 | 1632580 | 1632858 | + | NZ_CP061511.1 | Mixta calida |
| 36 | 1696887 | 1697165 | + | NZ_LR134340.1 | Escherichia marmotae |
| 37 | 2719833 | 2720111 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 38 | 1030064 | 1030342 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 39 | 1159536 | 1159814 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 40 | 1017987 | 1018265 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 41 | 96700 | 96978 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 42 | 2891113 | 2891355 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 43 | 2540540 | 2540812 | + | NZ_CP014056.2 | Grimontia hollisae |
| 44 | 1041706 | 1041984 | + | NZ_AP014857.1 | Escherichia albertii |
| 45 | 1758968 | 1759246 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 46 | 2961651 | 2961929 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 47 | 3143765 | 3144004 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 48 | 4514638 | 4514880 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 49 | 3975426 | 3975704 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 50 | 1002147 | 1002389 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 51 | 860086 | 860310 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 52 | 961547 | 961825 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 53 | 1531142 | 1531393 | - | NZ_CP033078.1 | Vibrio zhugei |
| 54 | 1879175 | 1879453 | + | NZ_CP043727.1 | Yersinia canariae |
| 55 | 859052 | 859276 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014524.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17785.3 | 0.87 | 47 | 238.0 | opposite-strand | PUA-like domain |
| 2 | PF04358.15 | 0.94 | 51 | 28.0 | opposite-strand | DsrC like protein |
| 3 | PF01027.22 | 0.89 | 48 | 495 | opposite-strand | Inhibitor of apoptosis-promoting Bax1 |
++ More..