Result : P45863
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwjC |
| NCBI Accession ID | Z49782.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2602 |
| Right | 2874 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAATATCAAGTCTCTGAAAGTAGCCGCACAGGCCTTTACTTTAAGAAATTTGATTCATCTTTATAAAATGTGCCATTCCGGAAGCCACGAGGTTTATATTTATTCAAAGAAAACGATGTGCAAAATCAAAAGCTTAATTGAGCTTGAAACGTTCCGCATGGCTCATAATGAAAAGGAATATCTGATCGTAGTTGAAGGAACAAAAGCATCACAGCTCATTGAAAAATTCCAAAATCTCATCGAGCCTGCTGAGAGAGAAGCGCTCTAA |
| Sequence | MKNIKSLKVAAQAFTLRNLIHLYKMCHSGSHEVYIYSKKTMCKIKSLIELETFRMAHNEKEYLIVVEGTKASQLIEKFQNLIEPAEREAL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9353933 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P45863 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3818906 | 3819178 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2419853 | 2420125 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 3646033 | 3646305 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3708142 | 3708414 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3633359 | 3633631 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3691247 | 3691519 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3651606 | 3651878 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 369451 | 369723 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3676471 | 3676743 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 4004352 | 4004618 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 3798290 | 3798556 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1921013 | 1921267 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 4228828 | 4229094 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 3373011 | 3373265 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 1982559 | 1982813 | - | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05066.15 | 0.6 | 9 | 5844 | opposite-strand | HB1, ASXL, restriction endonuclease HTH domain |
| 2 | PF00441.26 | 0.67 | 10 | 4524 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 3 | PF02771.18 | 0.67 | 10 | 4524 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 4 | PF08028.13 | 0.67 | 10 | 4524 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 5 | PF02770.21 | 0.67 | 10 | 4524 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 6 | PF02754.18 | 1.0 | 15 | 2392 | opposite-strand | Cysteine-rich domain |
| 7 | PF13183.8 | 1.0 | 15 | 2392 | opposite-strand | 4Fe-4S dicluster domain |
| 8 | PF12838.9 | 0.8 | 12 | 2407.0 | opposite-strand | 4Fe-4S dicluster domain |
| 9 | PF13187.8 | 1.0 | 15 | 2392 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF13237.8 | 1.0 | 15 | 2399.5 | opposite-strand | 4Fe-4S dicluster domain |
| 11 | PF13091.8 | 0.93 | 14 | 1056.0 | same-strand | PLD-like domain |
| 12 | PF00614.24 | 0.93 | 14 | 1056.0 | same-strand | Phospholipase D Active site motif |
| 13 | PF03851.16 | 0.8 | 12 | 81.0 | same-strand | UV-endonuclease UvdE |
| 14 | PF00664.25 | 0.73 | 11 | 576 | opposite-strand | ABC transporter transmembrane region |
| 15 | PF00005.29 | 0.73 | 11 | 576 | opposite-strand | ABC transporter |
| 16 | PF13396.8 | 0.8 | 12 | 2392.0 | opposite-strand | Phospholipase D-nuclease N-terminal |
| 17 | PF02665.16 | 0.6 | 9 | 4548 | opposite-strand | Nitrate reductase gamma subunit |
++ More..