ProsmORF-pred
Result : P45795
Protein Information
Information Type Description
Protein name Uncharacterized protein YrdB
NCBI Accession ID U18997.1
Organism Escherichia coli (strain K12)
Left 210512
Right 210769
Strand -
Nucleotide Sequence GTGAATCAGGCCATCCAGTTTCCGGACAGGGAAGAGTGGGACGAGAATAAAAAATGTGTATGTTTTCCCGCTCTCGTGAATGGTATGCAACTGACATGCGCGATCTCTGGCGAGAGTCTGGCGTATCGCTTTACTGGAGATACGCCAGAACAGTGGTTAGCGAGTTTTCGTCAGCATCGCTGGGACCTGGAAGAAGAAGCGGAAAACTTAATTCAGGAACAAAGTGAAGATGATCAAGGCTGGGTCTGGTTACCCTGA
Sequence MNQAIQFPDREEWDENKKCVCFPALVNGMQLTCAISGESLAYRFTGDTPEQWLASFRQHRWDLEEEAENLIQEQSEDDQGWVWLP
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam07369. Profile Description: Protein of unknown function (DUF1488). This family consists of several hypothetical bacterial proteins of around 85 residues in length. The function of this family is unknown.
Pubmed ID 9278503 16738553
Domain CDD:399977
Functional Category Others
Uniprot ID P45795
ORF Length (Amino Acid) 85
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 106
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3429766 3430023 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 395062 395319 + NZ_CP061527.1 Shigella dysenteriae
3 3412555 3412812 - NC_004337.2 Shigella flexneri 2a str. 301
4 4164906 4165163 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
5 2351057 2351314 - NZ_CP057657.1 Escherichia fergusonii
6 3405773 3406030 - NZ_AP014857.1 Escherichia albertii
7 3932944 3933201 - NZ_LR134340.1 Escherichia marmotae
8 1676129 1676386 + NZ_LT556085.1 Citrobacter amalonaticus
9 4328113 4328370 - NC_009792.1 Citrobacter koseri ATCC BAA-895
10 1233997 1234254 - NZ_CP026047.1 Raoultella planticola
11 4780450 4780707 + NC_013716.1 Citrobacter rodentium ICC168
12 2850845 2851102 + NZ_CP044098.1 Citrobacter portucalensis
13 482508 482765 + NZ_CP046672.1 Raoultella ornithinolytica
14 3818359 3818616 + NZ_CP027107.1 Cronobacter sakazakii
15 4157395 4157652 - NZ_CP012871.1 [Enterobacter] lignolyticus
16 2674330 2674587 - NZ_CP016337.1 Kosakonia sacchari
17 4424393 4424650 - NZ_CP063425.1 Kosakonia pseudosacchari
18 99586 99843 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
19 2231771 2232028 - NZ_CP033744.1 Citrobacter freundii
20 245614 245871 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
21 3868063 3868320 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
22 444170 444427 + NZ_CP041247.1 Raoultella electrica
23 6178 6435 - NZ_CP045205.1 Citrobacter telavivensis
24 3580281 3580538 + NZ_CP045300.1 Kosakonia arachidis
25 3573019 3573276 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
26 3849223 3849480 + NZ_CP038469.1 Citrobacter tructae
27 472621 472878 + NZ_CP014007.2 Kosakonia oryzae
28 410932 411189 + NZ_CP054058.1 Scandinavium goeteborgense
29 445738 445995 + NZ_CP050508.1 Raoultella terrigena
30 4851363 4851620 - NZ_CP015113.1 Kosakonia radicincitans
31 4035310 4035567 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
32 1423145 1423402 - NZ_CP053416.1 Salmonella bongori
33 3945428 3945685 - NZ_CP012264.1 Cronobacter condimenti 1330
34 443598 443855 + NZ_CP065838.1 Klebsiella quasipneumoniae
35 447402 447659 + NZ_LR134475.1 Klebsiella aerogenes
36 526286 526543 + NZ_CP060111.1 Klebsiella michiganensis
37 4847377 4847634 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
38 999975 1000232 + NZ_CP051548.1 Phytobacter diazotrophicus
39 453134 453391 + NZ_CP054254.1 Klebsiella variicola
40 426986 427243 + NZ_CP035129.1 Kosakonia cowanii
41 255078 255335 + NZ_CP023525.1 Cedecea neteri
42 4273401 4273649 - NZ_CP017184.1 Enterobacter roggenkampii
43 3026176 3026424 + NZ_CP025034.2 Enterobacter sp. SGAir0187
44 2006318 2006566 - NZ_AP019007.1 Enterobacter oligotrophicus
45 4377414 4377662 - NZ_CP009756.1 Enterobacter cloacae
46 4247503 4247754 + NZ_CP028271.1 Mixta intestinalis
47 259593 259850 + NZ_LR134201.1 Cedecea lapagei
48 4609517 4609765 - NZ_CP043318.1 Enterobacter chengduensis
49 4180480 4180728 - NZ_AP022508.1 Enterobacter bugandensis
50 332282 332539 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
51 5160903 5161160 + NZ_CP011602.1 Phytobacter ursingii
52 4073257 4073505 + NZ_CP045769.1 Enterobacter cancerogenus
53 565430 565687 + NZ_CP036175.1 Klebsiella huaxiensis
54 2835958 2836206 - NZ_CP017279.1 Enterobacter ludwigii
55 480277 480534 + NZ_CP045845.1 Kluyvera intermedia
56 4254465 4254713 - NZ_CP027986.1 Enterobacter sichuanensis
57 690069 690320 - NZ_CP040428.1 Jejubacter calystegiae
58 2974993 2975241 - NZ_CP023529.1 Lelliottia amnigena
59 1166631 1166879 - NZ_CP019706.1 Pantoea alhagi
60 498559 498810 + NZ_CP026377.1 Mixta gaviniae
61 468418 468666 + NZ_CP013990.1 Leclercia adecarboxylata
62 2137074 2137331 + NZ_CP042941.1 Atlantibacter hermannii
63 4287865 4288113 - NC_015968.1 Enterobacter soli
64 442375 442635 + NZ_LN907827.1 Erwinia gerundensis
65 423951 424202 + NZ_CP061511.1 Mixta calida
66 4819444 4819701 + NZ_CP014137.1 Brenneria goodwinii
67 4567802 4568053 - NC_014306.1 Erwinia billingiae Eb661
68 1201004 1201252 + NZ_CP020388.1 Pluralibacter gergoviae
69 1115964 1116221 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
70 414343 414600 + NZ_AP023184.1 Buttiauxella agrestis
71 4384160 4384417 - NZ_CP009125.1 Pectobacterium atrosepticum
72 4755494 4755751 + NZ_CP015749.1 Pectobacterium parmentieri
73 126418 126675 + NZ_CP015581.1 Tatumella citrea
74 3591683 3591940 - NZ_CP034148.1 Pantoea agglomerans
75 499221 499478 + NZ_CP051652.1 Pectobacterium carotovorum
76 4214255 4214512 - NZ_CP038498.1 Pectobacterium punjabense
77 2157442 2157699 + NZ_CP047495.1 Pectobacterium brasiliense
78 479653 479910 + NZ_CP045720.1 Pantoea eucalypti
79 3187492 3187749 - NZ_CP017482.1 Pectobacterium polaris
80 489759 490016 + NZ_CP038853.1 Pantoea vagans
81 3507334 3507594 - NC_010694.1 Erwinia tasmaniensis Et1/99
82 2427793 2428050 - NZ_CP049115.1 Pantoea stewartii
83 4374696 4374953 - NZ_CP034938.1 Pectobacterium odoriferum
84 507639 507896 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
85 3460462 3460722 - NC_013961.1 Erwinia amylovora CFBP1430
86 477940 478197 + NC_017554.1 Pantoea ananatis PA13
87 540629 540886 + NZ_CP065044.1 Pectobacterium aroidearum
88 335800 336060 + NZ_CP023567.1 Erwinia pyrifoliae
89 4851489 4851749 - NC_012962.1 Photorhabdus asymbiotica
90 3337208 3337477 + NZ_CP009460.1 Dickeya fangzhongdai
91 1625350 1625619 - NZ_CP015137.1 Dickeya solani IPO 2222
92 5475915 5476178 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
93 4405522 4405791 - NZ_CP031560.1 Dickeya dianthicola
94 4368643 4368912 - NC_014500.1 Dickeya dadantii 3937
95 495506 495775 + NZ_CP042220.2 Dickeya poaceiphila
96 4169785 4170054 - NZ_CP072455.1 Xenorhabdus budapestensis
97 1664094 1664354 - NZ_CP011104.1 Photorhabdus thracensis
98 4168722 4168994 - NZ_CP025799.1 Dickeya zeae
99 3143615 3143884 - NZ_CP016176.1 Xenorhabdus hominickii
100 728465 728719 - NZ_CP023009.1 Lonsdalea britannica
101 293366 293635 + NZ_FO704550.1 Xenorhabdus doucetiae
102 3467740 3468009 - NZ_FO704551.1 Xenorhabdus poinarii G6
103 4236174 4236434 - NZ_CP050150.1 Hafnia alvei
104 3147993 3148265 - NZ_CP060401.1 Xenorhabdus nematophila
105 4084499 4084774 - NZ_LS483422.1 Providencia heimbachae
106 1211855 1212115 + NZ_CP023536.1 Providencia alcalifaciens
107 4078921 4079181 - NZ_CP048796.1 Providencia vermicola
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00132.26 1.0 106 -24 opposite-strand Bacterial transferase hexapeptide (six repeats)
2 PF14602.8 0.75 80 -24 opposite-strand Hexapeptide repeat of succinyl-transferase
3 PF08501.13 0.99 105 -3.0 same-strand Shikimate dehydrogenase substrate binding domain
4 PF18317.3 0.97 103 -3.0 same-strand Shikimate 5'-dehydrogenase C-terminal domain
5 PF01300.20 1.0 106 820 same-strand Telomere recombination
6 PF01396.21 0.97 103 1389.0 same-strand Topoisomerase DNA binding C4 zinc finger
7 PF04361.15 0.9 95 1966.0 same-strand Protein of unknown function (DUF494)
8 PF02481.17 0.99 105 2411.0 same-strand DNA recombination-mediator protein A
++ More..