Result : P45693
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Stage V sporulation protein S |
| NCBI Accession ID | U27501.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 327 |
| Right | 587 |
| Strand | + |
| Nucleotide Sequence | ATGGAAATCTTAAAAGTTTCAGCAAAATCGAGTCCAAATTCAGTGGCAGGTGCGCTTGCAGGCGTGTTGAGAGAGCGAGGAGCCGCCGAGATTCAAGCGATCGGAGCGGGTGCATTAAACCAGGCTGTAAAAGCTGTGGCGATTGCCAGGGGATTTGTGGCGCCAAGCGGCGTTGATTTGATTTGTATTCCGGCTTTTACAGATATTCAAATCGATGGGGAAGAAAGAACAGCGATTAAATTAATCGTGGAGCCTCGCTAA |
| Sequence | MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDLICIPAFTDIQIDGEERTAIKLIVEPR |
| Source of smORF | Swiss-Prot |
| Function | Induced early in sporulation under the control of sigma-H. Interferes with sporulation at an early stage. Seems to play a positive role in allowing cells to progress beyond stage V of sporulation. |
| Pubmed ID | 7559352 9384377 |
| Domain | CDD:412697 |
| Functional Category | Others |
| Uniprot ID | P45693 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 310
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2232704 | 2232964 | - | NZ_CP011937.1 | Bacillus velezensis |
| 2 | 1948804 | 1949064 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 1677549 | 1677809 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1728149 | 1728409 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 1774162 | 1774422 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 1737811 | 1738071 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 1742861 | 1743121 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 215873 | 216133 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 1769935 | 1770195 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 10 | 1776541 | 1776801 | - | NZ_CP012024.1 | Bacillus smithii |
| 11 | 3889840 | 3890100 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 12 | 1818464 | 1818724 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 13 | 1274302 | 1274562 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 14 | 3302500 | 3302760 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 15 | 1881714 | 1881974 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 1904364 | 1904624 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 17 | 2046916 | 2047176 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 18 | 1184595 | 1184855 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 19 | 3317324 | 3317584 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 20 | 2050799 | 2051059 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 21 | 119038 | 119298 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 22 | 2578450 | 2578710 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 23 | 1234609 | 1234869 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 24 | 1186343 | 1186603 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 25 | 1229703 | 1229963 | + | NZ_CP020953.1 | Clostridium drakei |
| 26 | 1178919 | 1179179 | + | NZ_CP020953.1 | Clostridium drakei |
| 27 | 191106 | 191366 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 28 | 140193 | 140453 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 29 | 3038170 | 3038430 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 30 | 3089031 | 3089291 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 31 | 2210982 | 2211242 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 32 | 15048 | 15308 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 33 | 1684797 | 1685057 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 34 | 3622307 | 3622567 | - | NZ_CP043404.1 | Bacillus safensis |
| 35 | 2262076 | 2262336 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 36 | 2471806 | 2472066 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 37 | 1873264 | 1873524 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 38 | 2173404 | 2173664 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 39 | 4857977 | 4858237 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 40 | 1490600 | 1490860 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 41 | 4338508 | 4338768 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 42 | 854840 | 855100 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 43 | 44089 | 44349 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 44 | 2279689 | 2279949 | + | NZ_CP053989.1 | Niallia circulans |
| 45 | 1533630 | 1533890 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 46 | 2046244 | 2046504 | - | NZ_CP009687.1 | Clostridium aceticum |
| 47 | 719580 | 719840 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 48 | 2617436 | 2617696 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 49 | 2294104 | 2294364 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 50 | 2722932 | 2723192 | + | NZ_CP026363.1 | Brevibacillus agri |
| 51 | 2528462 | 2528722 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 52 | 3024264 | 3024524 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 53 | 1638938 | 1639198 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 54 | 1621645 | 1621905 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 55 | 3666394 | 3666654 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 56 | 2289778 | 2290038 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 57 | 2477755 | 2478015 | - | NZ_CP028842.1 | Clostridium botulinum |
| 58 | 2740790 | 2741050 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 59 | 1901365 | 1901625 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 60 | 1319248 | 1319508 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 61 | 406547 | 406807 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 62 | 2663564 | 2663824 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 63 | 768976 | 769236 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 64 | 242406 | 242666 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 65 | 1758416 | 1758676 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 66 | 1760414 | 1760674 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 67 | 1619695 | 1619955 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 68 | 2702284 | 2702544 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 69 | 1417603 | 1417863 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 70 | 3508640 | 3508900 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 71 | 1344100 | 1344360 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 72 | 1244414 | 1244674 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 73 | 2624113 | 2624373 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 74 | 2165409 | 2165669 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 75 | 314640 | 314900 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 76 | 1782266 | 1782526 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 77 | 545128 | 545388 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 78 | 1920975 | 1921235 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 79 | 1595807 | 1596067 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 80 | 1387733 | 1387993 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 81 | 1436562 | 1436822 | - | NZ_CP034118.1 | Staphylospora marina |
| 82 | 3295037 | 3295297 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 83 | 2930941 | 2931201 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 84 | 2340666 | 2340926 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 85 | 2495176 | 2495436 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 86 | 1227317 | 1227577 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 87 | 1316793 | 1317053 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 88 | 1651305 | 1651565 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 89 | 505077 | 505337 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 90 | 1350166 | 1350426 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 91 | 3879231 | 3879491 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 92 | 3951734 | 3951994 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 93 | 6266824 | 6267084 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 94 | 1191585 | 1191845 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 95 | 6265364 | 6265624 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 96 | 1893874 | 1894134 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 97 | 2465347 | 2465607 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 98 | 1918127 | 1918387 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 99 | 1655586 | 1655846 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 100 | 1085888 | 1086148 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 101 | 1034563 | 1034823 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 102 | 1159020 | 1159280 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 103 | 3693405 | 3693665 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 104 | 2239714 | 2239974 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 105 | 3408752 | 3409012 | + | NZ_CP034437.1 | Paenibacillus albus |
| 106 | 4692408 | 4692668 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 107 | 2486456 | 2486716 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 108 | 1921819 | 1922079 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 109 | 790006 | 790266 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 110 | 2712752 | 2713012 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 111 | 4663687 | 4663947 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 112 | 4204648 | 4204908 | - | NZ_AP019400.1 | Cohnella abietis |
| 113 | 1969786 | 1970046 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 114 | 1898295 | 1898555 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 115 | 1319578 | 1319838 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 116 | 1412748 | 1413008 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 117 | 1396730 | 1396990 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 118 | 1489645 | 1489905 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 119 | 1388090 | 1388350 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 120 | 1489930 | 1490190 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 121 | 1136515 | 1136775 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 122 | 2059399 | 2059659 | + | NZ_CP036259.1 | Sporomusa termitida |
| 123 | 1912171 | 1912431 | + | NZ_CP036259.1 | Sporomusa termitida |
| 124 | 1224211 | 1224471 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 125 | 1310710 | 1310970 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 126 | 1226612 | 1226872 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 127 | 1314713 | 1314973 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 128 | 1198908 | 1199168 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 129 | 1288912 | 1289172 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 130 | 1336868 | 1337128 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 131 | 1426534 | 1426794 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 132 | 2372647 | 2372907 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 133 | 2172734 | 2172994 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 134 | 3148965 | 3149225 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 135 | 3667041 | 3667301 | - | NZ_CP009288.1 | Paenibacillus durus |
| 136 | 2350019 | 2350279 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 137 | 1440988 | 1441248 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 138 | 3334901 | 3335161 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 139 | 4065413 | 4065673 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 140 | 6057516 | 6057776 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 141 | 4124707 | 4124967 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 142 | 6192986 | 6193246 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 143 | 4655752 | 4656012 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 144 | 4839363 | 4839623 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 145 | 2913656 | 2913916 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 146 | 1622087 | 1622347 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 147 | 1743201 | 1743464 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 148 | 1938084 | 1938344 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 149 | 5608844 | 5609104 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 150 | 1101771 | 1102031 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 151 | 1048158 | 1048418 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 152 | 1182014 | 1182274 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 153 | 1045794 | 1046054 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 154 | 2103892 | 2104152 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 155 | 3006434 | 3006694 | - | NZ_CP014176.1 | Clostridium argentinense |
| 156 | 3616556 | 3616816 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 157 | 2922132 | 2922392 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 158 | 2105228 | 2105488 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 159 | 1280771 | 1281031 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 160 | 782581 | 782841 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 161 | 6214495 | 6214755 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 162 | 933402 | 933626 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 163 | 3201910 | 3202170 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 164 | 1949656 | 1949916 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 165 | 1965233 | 1965493 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 166 | 2461801 | 2462061 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 167 | 3614019 | 3614279 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 168 | 2671225 | 2671485 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 169 | 1667305 | 1667565 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 170 | 3948160 | 3948420 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 171 | 1566922 | 1567182 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 172 | 1768329 | 1768589 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 173 | 2801525 | 2801785 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 174 | 3566929 | 3567189 | + | NZ_CP021434.1 | Tumebacillus avium |
| 175 | 1164167 | 1164427 | + | NZ_CP033433.1 | Cohnella candidum |
| 176 | 4478336 | 4478596 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 177 | 3383590 | 3383850 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 178 | 2567889 | 2568149 | - | NZ_LS483476.1 | Lederbergia lentus |
| 179 | 910970 | 911230 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 180 | 1998362 | 1998622 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 181 | 835300 | 835560 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 182 | 535294 | 535554 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 183 | 2476275 | 2476535 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 184 | 2689563 | 2689823 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 185 | 1901370 | 1901630 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 186 | 1723287 | 1723547 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 187 | 4123022 | 4123282 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 188 | 4241003 | 4241263 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 189 | 1472867 | 1473127 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 190 | 2513094 | 2513354 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 191 | 1572318 | 1572578 | + | NZ_CP040336.1 | Bacillus luti |
| 192 | 3054595 | 3054870 | - | NZ_CP040336.1 | Bacillus luti |
| 193 | 3586980 | 3587240 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 194 | 2011901 | 2012176 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 195 | 3614605 | 3614865 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 196 | 2084004 | 2084279 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 197 | 3791983 | 3792243 | - | NC_011725.1 | Bacillus cereus B4264 |
| 198 | 2064051 | 2064326 | + | NC_011725.1 | Bacillus cereus B4264 |
| 199 | 3795166 | 3795426 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 200 | 2099479 | 2099754 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 201 | 720092 | 720352 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 202 | 1940866 | 1941126 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 203 | 1371923 | 1372183 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 204 | 2233121 | 2233381 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 205 | 1889110 | 1889370 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 206 | 1185417 | 1185677 | + | NZ_CP048649.1 | Aminipila butyrica |
| 207 | 880302 | 880568 | + | NZ_CP048649.1 | Aminipila butyrica |
| 208 | 526460 | 526726 | + | NZ_CP048649.1 | Aminipila butyrica |
| 209 | 1276506 | 1276766 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 210 | 1157887 | 1158147 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 211 | 4756940 | 4757200 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 212 | 1044363 | 1044623 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 213 | 1353244 | 1353504 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 214 | 1440468 | 1440728 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 215 | 628555 | 628815 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 216 | 1371451 | 1371711 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 217 | 1476247 | 1476507 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 218 | 3346410 | 3346670 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 219 | 2350497 | 2350757 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 220 | 1346965 | 1347225 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 221 | 1788189 | 1788449 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 222 | 1550428 | 1550688 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 223 | 1435340 | 1435600 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 224 | 861591 | 861857 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 225 | 1075849 | 1076109 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 226 | 2868230 | 2868490 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 227 | 2107603 | 2107863 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 228 | 1178108 | 1178368 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 229 | 1040346 | 1040606 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 230 | 1117946 | 1118206 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 231 | 1011844 | 1012104 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 232 | 3585937 | 3586197 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 233 | 1531663 | 1531923 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 234 | 1433299 | 1433559 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 235 | 1543258 | 1543518 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 236 | 1973676 | 1973936 | + | NZ_CP019870.1 | Clostridioides difficile |
| 237 | 1539482 | 1539742 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 238 | 988589 | 988849 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 239 | 1430346 | 1430594 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 240 | 1887753 | 1888013 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 241 | 821371 | 821589 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 242 | 649372 | 649635 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 243 | 1612983 | 1613243 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 244 | 605495 | 605755 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 245 | 1490106 | 1490366 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 246 | 1622610 | 1622879 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 247 | 2716927 | 2717187 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 248 | 1247433 | 1247693 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 249 | 1440627 | 1440887 | + | NZ_CP043998.1 | Clostridium diolis |
| 250 | 1632269 | 1632529 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 251 | 1217121 | 1217381 | + | NZ_CP030775.1 | Clostridium butyricum |
| 252 | 1402124 | 1402384 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 253 | 1842808 | 1843068 | - | NZ_HG917868.1 | Clostridium bornimense |
| 254 | 2084995 | 2085255 | - | NZ_HG917868.1 | Clostridium bornimense |
| 255 | 3805309 | 3805554 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 256 | 1965629 | 1965892 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 257 | 2161087 | 2161347 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 258 | 1507513 | 1507773 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 259 | 1126173 | 1126433 | - | NZ_CP016786.1 | Clostridium isatidis |
| 260 | 1041879 | 1042148 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 261 | 898668 | 898928 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 262 | 545955 | 546215 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 263 | 1326343 | 1326603 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 264 | 1642986 | 1643246 | - | NZ_CP014204.2 | Clostridium baratii |
| 265 | 1347921 | 1348187 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 266 | 1524779 | 1525039 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 267 | 141972 | 142232 | - | NZ_CP023671.1 | Clostridium septicum |
| 268 | 1645167 | 1645430 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 269 | 1960836 | 1961096 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 270 | 1167880 | 1168143 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 271 | 1331347 | 1331610 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 272 | 625538 | 625804 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 273 | 2411136 | 2411399 | - | NZ_LS974202.1 | Mesotoga infera |
| 274 | 2252227 | 2252499 | - | NZ_LS974202.1 | Mesotoga infera |
| 275 | 1301859 | 1302122 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 276 | 550625 | 550903 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 277 | 1132618 | 1132881 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 278 | 477028 | 477288 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 279 | 1410740 | 1411000 | - | NC_008593.1 | Clostridium novyi NT |
| 280 | 356392 | 356655 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 281 | 1868806 | 1869093 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 282 | 1977664 | 1977933 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 283 | 489804 | 490067 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 284 | 1475294 | 1475557 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 285 | 1643522 | 1643800 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 286 | 1297015 | 1297278 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 287 | 528541 | 528816 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 288 | 3636166 | 3636426 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 289 | 1837442 | 1837702 | + | NZ_CP040924.1 | Clostridium thermarum |
| 290 | 1259068 | 1259331 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 291 | 1945783 | 1946058 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 292 | 126232 | 126495 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 293 | 1069940 | 1070215 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 294 | 355114 | 355377 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 295 | 1339588 | 1339860 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 296 | 1701195 | 1701458 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 297 | 857109 | 857372 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 298 | 25814 | 26089 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 299 | 1694414 | 1694677 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 300 | 737450 | 737713 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 301 | 26104 | 26379 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 302 | 1742341 | 1742604 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 303 | 739541 | 739804 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 304 | 25814 | 26089 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 305 | 154130 | 154393 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 306 | 34069 | 34368 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 307 | 200884 | 201156 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 308 | 206056 | 206319 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 309 | 222576 | 222848 | - | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 310 | 230002 | 230265 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 311 | 2113172 | 2113435 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 312 | 944413 | 944676 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 313 | 1462567 | 1462839 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 314 | 939136 | 939399 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 315 | 1474583 | 1474855 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 316 | 1645913 | 1646173 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 317 | 1292131 | 1292403 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 318 | 657698 | 657967 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 319 | 175837 | 176115 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 320 | 529314 | 529577 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 321 | 1360359 | 1360631 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 322 | 1513299 | 1513559 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 323 | 1167161 | 1167427 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 324 | 3505755 | 3506021 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 325 | 3624672 | 3624938 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 326 | 566973 | 567233 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 327 | 793708 | 793968 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 328 | 3125752 | 3125967 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 329 | 1569282 | 1569548 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 330 | 1906520 | 1906780 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 331 | 3177812 | 3178075 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 332 | 2572303 | 2572563 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 333 | 1109202 | 1109462 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 334 | 2070263 | 2070484 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 335 | 83688 | 83960 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 336 | 617526 | 617786 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 337 | 1120787 | 1121008 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 338 | 1720423 | 1720695 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 339 | 679978 | 680241 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 340 | 1643408 | 1643644 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 341 | 636382 | 636642 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 342 | 2645356 | 2645616 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 343 | 1704236 | 1704496 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 344 | 2812410 | 2812670 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 345 | 1255560 | 1255820 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 346 | 2886553 | 2886813 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 347 | 1062526 | 1062786 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 348 | 2396777 | 2397037 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 349 | 1488768 | 1489028 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 350 | 2501252 | 2501512 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 351 | 1599919 | 1600179 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 352 | 2736566 | 2736826 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 353 | 1202311 | 1202571 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 354 | 2756965 | 2757225 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 355 | 1449660 | 1449932 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 356 | 1768273 | 1768569 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 357 | 1685969 | 1686229 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 358 | 28416 | 28676 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 359 | 1770159 | 1770419 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 360 | 30182 | 30442 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 361 | 777856 | 778101 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 362 | 218477 | 218737 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 363 | 1123642 | 1123893 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 364 | 1731711 | 1731965 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 365 | 1020140 | 1020421 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 366 | 856659 | 856916 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 367 | 2442938 | 2443198 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 368 | 1162076 | 1162336 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 369 | 603398 | 603658 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 370 | 1691739 | 1691999 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 371 | 3366619 | 3366888 | + | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 372 | 3083444 | 3083749 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 373 | 813471 | 813743 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 374 | 1177775 | 1178047 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 375 | 1339202 | 1339489 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 376 | 363146 | 363418 | - | NZ_CP016312.1 | Thermus brockianus |
| 377 | 1283297 | 1283569 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 378 | 995511 | 995783 | - | NZ_CP038452.1 | Thermus caldilimi |
| 379 | 1532312 | 1532584 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 380 | 1201464 | 1201736 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 381 | 1706632 | 1706904 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 382 | 898039 | 898290 | + | NZ_CP009302.1 | Berryella intestinalis |
| 383 | 1283403 | 1283675 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 384 | 885115 | 885351 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 385 | 2114615 | 2114893 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 386 | 1655078 | 1655338 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 387 | 3697924 | 3698193 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 388 | 3135270 | 3135530 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 389 | 1846174 | 1846446 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 390 | 327070 | 327330 | + | NZ_AP018437.1 | Pelolinea submarina |
| 391 | 2572425 | 2572700 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 392 | 1360736 | 1361014 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 393 | 1554081 | 1554374 | - | NZ_CP021081.1 | Deinococcus ficus |
| 394 | 1363076 | 1363306 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 395 | 148431 | 148715 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 396 | 1476927 | 1477211 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 397 | 1625255 | 1625512 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011937.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12072.10 | 0.72 | 224 | 1047.5 | same-strand | RNase Y N-terminal region |
| 2 | PF01966.24 | 0.78 | 241 | 1050.5 | same-strand | HD domain |
| 3 | PF00013.31 | 0.72 | 223 | 1039 | same-strand | KH domain |
| 4 | PF00154.23 | 0.62 | 191 | 3233 | same-strand | recA bacterial DNA recombination protein |
| 5 | PF08423.13 | 0.62 | 191 | 3233 | same-strand | Rad51 |
++ More..