Result : P45688
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Carboxysome shell protein CsoS1C |
| NCBI Accession ID | AF038430.1 |
| Organism | Halothiobacillus neapolitanus (strain ATCC 23641 / c2) (Thiobacillus neapolitanus) |
| Left | 6726 |
| Right | 7022 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGCAGTAACAGGTATTGCACTGGGTATGATTGAAACACGTGGTCTGGTTCCAGCGATTGAAGCTGCCGATGCCATGACCAAGGCCGCCGAAGTACGTTTGGTTGGCCGTCAATTTGTTGGTGGTGGTTACGTGACCGTTTTGGTCCGTGGTGAAACCGGTGCCGTCAACGCAGCAGTTCGTGCGGGCGCTGATGCCTGCGAACGAGTCGGCGATGGTCTGGTCGCGGCGCATATCATTGCCCGTGTCCATTCCGAAGTCGAAAACATCCTGCCGAAAGCCCCTGAAGCTTAA |
| Sequence | MAAVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPEA |
| Source of smORF | Swiss-Prot |
| Function | One of shell proteins of the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, ccbL-ccbS) is sequestered. Assembles into hexamers which make sheets that form the facets of the polyhedral carboxysome (Probable). The shell probably limits the diffusion of CO(2) into and out of the carboxysome (Probable). There are estimated to be 2970 CsoS1A/CsoS1C proteins per carboxysome (the proteins differ by only 1 residue) (Ref.4). {ECO:0000269|Ref.4, ECO:0000305|Pubmed:18258595, ECO:0000305|Pubmed:19690376}.; Unlike beta-carboxysomes, alpha-carboxysomes (Cb) can form without cargo protein. CsoS2 is essential for Cb formation and is also capable of targeting foreign proteins to the Cb. The Cb shell assembles with the aid of CsoS2; CsoS1A, CsoS1B and CsoS1C form the majority of the shell while CsoS4A and CsoS4B form vertices. CsoS1D forms pseudohexamers that probably control metabolite flux into and out of the shell. {ECO:0000269|Pubmed:33116131}. |
| Pubmed ID | 7934888 9696760 18258595 22184212 30305640 33116131 19690376 |
| Domain | CDD:413144 |
| Functional Category | Others |
| Uniprot ID | P45688 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 352
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 839981 | 840277 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 2 | 839615 | 839911 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 3 | 839149 | 839448 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 4 | 1490582 | 1490878 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 5 | 1490243 | 1490539 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 6 | 1489781 | 1490119 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 7 | 3065189 | 3065527 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 8 | 3065573 | 3065869 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 9 | 2474515 | 2474811 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 10 | 2474084 | 2474422 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 11 | 2474866 | 2475162 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 12 | 3296429 | 3296755 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 13 | 3297132 | 3297425 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 14 | 3296797 | 3297090 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 15 | 3163913 | 3164239 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 16 | 3164291 | 3164584 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 17 | 3164637 | 3164930 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 18 | 2388822 | 2389160 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 19 | 2389206 | 2389502 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 20 | 2389547 | 2389843 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 21 | 1456632 | 1456970 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 22 | 1457016 | 1457312 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 23 | 1457357 | 1457653 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 24 | 2155824 | 2156120 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 25 | 2156163 | 2156459 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 26 | 2155403 | 2155741 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 27 | 2499005 | 2499301 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 28 | 2498637 | 2498975 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 29 | 2531077 | 2531373 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 30 | 2530702 | 2531040 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 31 | 234558 | 234875 | + | NZ_CP072793.1 | Thiothrix unzii |
| 32 | 234918 | 235208 | + | NZ_CP072793.1 | Thiothrix unzii |
| 33 | 315730 | 316026 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 34 | 316422 | 316760 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 35 | 316075 | 316374 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 36 | 2167601 | 2167897 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 37 | 2167218 | 2167526 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 38 | 829498 | 829845 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 39 | 829160 | 829456 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 40 | 1980623 | 1980961 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 41 | 1980239 | 1980535 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 42 | 1979873 | 1980169 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 43 | 284039 | 284305 | + | NC_007959.1 | Nitrobacter hamburgensis X14 |
| 44 | 284348 | 284695 | + | NC_007959.1 | Nitrobacter hamburgensis X14 |
| 45 | 3346087 | 3346413 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 46 | 3346505 | 3346744 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 47 | 3346830 | 3347096 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 48 | 2038059 | 2038340 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 49 | 2038440 | 2038700 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 50 | 2038765 | 2039031 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 51 | 135595 | 135894 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
| 52 | 135934 | 136233 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
| 53 | 136273 | 136584 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
| 54 | 2252300 | 2252605 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 55 | 2252672 | 2252965 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 56 | 2244947 | 2245240 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 57 | 2244593 | 2244880 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 58 | 3480966 | 3481274 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 59 | 3481310 | 3481570 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 60 | 3105052 | 3105321 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 61 | 3105453 | 3105713 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 62 | 519893 | 520159 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 63 | 520578 | 520862 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 64 | 520235 | 520495 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 65 | 520941 | 521219 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 66 | 3242102 | 3242368 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 67 | 3241697 | 3241963 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 68 | 2651481 | 2651735 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 69 | 2651854 | 2652111 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 70 | 2651115 | 2651384 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 71 | 3074874 | 3075128 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 72 | 3075248 | 3075505 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 73 | 3074508 | 3074777 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 74 | 355165 | 355425 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 75 | 354830 | 355093 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 76 | 355488 | 355769 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 77 | 14908 | 15165 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 78 | 7741 | 7995 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 79 | 1937701 | 1938006 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 80 | 1938110 | 1938403 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 81 | 1938432 | 1938674 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 82 | 317459 | 317767 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 83 | 416525 | 416812 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 84 | 416838 | 417146 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 85 | 317138 | 317416 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 86 | 316830 | 317096 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 87 | 230198 | 230491 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 88 | 229928 | 230167 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 89 | 230636 | 230893 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 90 | 2066821 | 2067132 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 91 | 2067172 | 2067468 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 92 | 2067518 | 2067808 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 93 | 1998724 | 1999023 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 94 | 1998340 | 1998648 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 95 | 1801098 | 1801397 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 96 | 1800714 | 1801022 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 97 | 2302038 | 2302283 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 98 | 2301662 | 2301907 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 99 | 2301277 | 2301555 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 100 | 524107 | 524385 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 101 | 531158 | 531415 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 102 | 2654558 | 2654839 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 103 | 2655210 | 2655473 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 104 | 2654893 | 2655150 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 105 | 339949 | 340212 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 106 | 340272 | 340529 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 107 | 340583 | 340864 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 108 | 780144 | 780434 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 109 | 786805 | 787044 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 110 | 3021342 | 3021596 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 111 | 3022124 | 3022381 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 112 | 2333383 | 2333655 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 113 | 2326447 | 2326704 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 114 | 1062481 | 1062747 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 115 | 3873825 | 3874076 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 116 | 3877502 | 3877741 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 117 | 1564999 | 1565256 | + | NZ_CP048649.1 | Aminipila butyrica |
| 118 | 2813618 | 2813881 | - | NZ_CP048649.1 | Aminipila butyrica |
| 119 | 1171369 | 1171632 | + | NZ_CP048649.1 | Aminipila butyrica |
| 120 | 2003446 | 2003709 | - | NZ_CP048649.1 | Aminipila butyrica |
| 121 | 2530512 | 2530775 | - | NZ_CP048649.1 | Aminipila butyrica |
| 122 | 3086951 | 3087208 | - | NZ_CP048649.1 | Aminipila butyrica |
| 123 | 3087244 | 3087501 | - | NZ_CP048649.1 | Aminipila butyrica |
| 124 | 1157660 | 1157965 | + | NZ_CP048649.1 | Aminipila butyrica |
| 125 | 2679465 | 2679722 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 126 | 3098261 | 3098521 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 127 | 2678549 | 2678803 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 128 | 1126961 | 1127227 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 129 | 757280 | 757570 | - | NZ_LT859958.1 | Brevefilum fermentans |
| 130 | 1936608 | 1936856 | + | NZ_LT859958.1 | Brevefilum fermentans |
| 131 | 3306213 | 3306470 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 132 | 3305253 | 3305507 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 133 | 993119 | 993391 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 134 | 355479 | 355718 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 135 | 354762 | 355001 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 136 | 1786730 | 1786984 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 137 | 1442527 | 1442790 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 138 | 2182631 | 2182870 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 139 | 2181917 | 2182156 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 140 | 1674282 | 1674560 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 141 | 1662527 | 1662829 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 142 | 1681138 | 1681398 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 143 | 2719780 | 2720049 | + | NZ_CP023671.1 | Clostridium septicum |
| 144 | 2707469 | 2707777 | + | NZ_CP023671.1 | Clostridium septicum |
| 145 | 860412 | 860675 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 146 | 852196 | 852441 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 147 | 1416898 | 1417155 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 148 | 2189907 | 2190176 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 149 | 1766669 | 1766932 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 150 | 3227139 | 3227405 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 151 | 1751723 | 1751974 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 152 | 1498080 | 1498337 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 153 | 4431874 | 4432158 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 154 | 5945287 | 5945550 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 155 | 1648848 | 1649120 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 156 | 1660341 | 1660583 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 157 | 850611 | 850862 | - | NZ_AP018437.1 | Pelolinea submarina |
| 158 | 4009022 | 4009291 | - | NZ_CP014176.1 | Clostridium argentinense |
| 159 | 4008677 | 4008946 | - | NZ_CP014176.1 | Clostridium argentinense |
| 160 | 2852211 | 2852453 | - | NZ_CP014176.1 | Clostridium argentinense |
| 161 | 4021322 | 4021630 | - | NZ_CP014176.1 | Clostridium argentinense |
| 162 | 83727 | 83978 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 163 | 81528 | 81809 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 164 | 83384 | 83635 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 165 | 2250912 | 2251181 | - | NZ_CP028842.1 | Clostridium botulinum |
| 166 | 2366805 | 2367074 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 167 | 1895838 | 1896125 | - | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 168 | 1297817 | 1298074 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 169 | 1830305 | 1830544 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 170 | 1829964 | 1830221 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 171 | 3820816 | 3821070 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 172 | 1304852 | 1305109 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 173 | 36428 | 36688 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 174 | 38664 | 38918 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 175 | 36783 | 37034 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 176 | 4917495 | 4917743 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 177 | 5254399 | 5254659 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 178 | 2220939 | 2221193 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 179 | 3607988 | 3608245 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 180 | 3593113 | 3593358 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 181 | 1075015 | 1075272 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 182 | 4360070 | 4360339 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 183 | 4344959 | 4345222 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 184 | 1961630 | 1961872 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 185 | 1600834 | 1601091 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 186 | 1962318 | 1962587 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 187 | 2809441 | 2809707 | - | NZ_CP014204.2 | Clostridium baratii |
| 188 | 2821513 | 2821812 | - | NZ_CP014204.2 | Clostridium baratii |
| 189 | 2222869 | 2223111 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 190 | 125931 | 126212 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 191 | 141688 | 141945 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 192 | 1806797 | 1807054 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 193 | 148425 | 148721 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 194 | 355434 | 355691 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 195 | 357374 | 357631 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 196 | 1365124 | 1365384 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 197 | 2086078 | 2086356 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 198 | 425430 | 425690 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 199 | 167217 | 167477 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 200 | 36025 | 36276 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 201 | 2318056 | 2318316 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 202 | 539516 | 539776 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 203 | 4257619 | 4257906 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 204 | 368033 | 368290 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 205 | 367713 | 367964 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 206 | 4272138 | 4272377 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 207 | 4272455 | 4272703 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 208 | 2026364 | 2026615 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 209 | 1718624 | 1718875 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 210 | 1721160 | 1721438 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 211 | 2028936 | 2029214 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 212 | 5629874 | 5630122 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 213 | 5644418 | 5644657 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 214 | 1758755 | 1759015 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 215 | 1751709 | 1752002 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 216 | 1823878 | 1824162 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 217 | 1824509 | 1824757 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 218 | 1824212 | 1824460 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 219 | 326782 | 327042 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 220 | 627001 | 627261 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
| 221 | 918640 | 918900 | - | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 222 | 5213666 | 5213911 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 223 | 397170 | 397427 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 224 | 396851 | 397102 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 225 | 5228338 | 5228577 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 226 | 5228655 | 5228903 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 227 | 5060817 | 5061086 | - | NZ_CP020953.1 | Clostridium drakei |
| 228 | 2517334 | 2517597 | + | NZ_CP020953.1 | Clostridium drakei |
| 229 | 4257738 | 4257998 | - | NZ_CP020953.1 | Clostridium drakei |
| 230 | 4262411 | 4262680 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 231 | 1402333 | 1402593 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 232 | 3370251 | 3370511 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 233 | 4854445 | 4854714 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 234 | 1743026 | 1743289 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 235 | 5683322 | 5683582 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 236 | 87929 | 88222 | + | NZ_CP041146.1 | Nocardioides humi |
| 237 | 1633840 | 1634097 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 238 | 1635779 | 1636036 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 239 | 1334273 | 1334539 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 240 | 1340980 | 1341225 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 241 | 1848891 | 1849142 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 242 | 1672061 | 1672312 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 243 | 1674839 | 1675117 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 244 | 1851562 | 1851840 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 245 | 4591907 | 4592152 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 246 | 4605222 | 4605461 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 247 | 4605540 | 4605788 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 248 | 264932 | 265210 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 249 | 271682 | 271957 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 250 | 750562 | 750813 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 251 | 750862 | 751113 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 252 | 735754 | 736011 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 253 | 6751938 | 6752180 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 254 | 2979434 | 2979721 | - | NZ_LR214441.1 | Tessaracoccus lapidicaptus |
| 255 | 432785 | 433045 | + | NZ_CP009687.1 | Clostridium aceticum |
| 256 | 3190769 | 3191047 | - | NZ_CP009687.1 | Clostridium aceticum |
| 257 | 468555 | 468815 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 258 | 2166855 | 2167115 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 259 | 3540508 | 3540786 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 260 | 1092235 | 1092495 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 261 | 1071660 | 1071917 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 262 | 1064952 | 1065239 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 263 | 1211028 | 1211288 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 264 | 1190454 | 1190711 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 265 | 1183752 | 1184039 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 266 | 892316 | 892594 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 267 | 891726 | 891998 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 268 | 892021 | 892293 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 269 | 877089 | 877346 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 270 | 1076972 | 1077229 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 271 | 2400430 | 2400687 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 272 | 999692 | 999946 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 273 | 1006366 | 1006632 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 274 | 1070170 | 1070466 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 275 | 1797230 | 1797499 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 276 | 636954 | 637214 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 277 | 2199882 | 2200121 | + | NZ_LT906439.1 | Streptococcus merionis |
| 278 | 379963 | 380214 | + | NZ_LT906439.1 | Streptococcus merionis |
| 279 | 2216118 | 2216366 | + | NZ_LT906439.1 | Streptococcus merionis |
| 280 | 379633 | 379899 | + | NZ_LT906439.1 | Streptococcus merionis |
| 281 | 2215500 | 2215757 | + | NZ_LT906439.1 | Streptococcus merionis |
| 282 | 2215809 | 2216066 | + | NZ_LT906439.1 | Streptococcus merionis |
| 283 | 1151334 | 1151594 | + | NZ_LT906444.1 | Listeria welshimeri |
| 284 | 1130767 | 1131024 | + | NZ_LT906444.1 | Listeria welshimeri |
| 285 | 1124064 | 1124351 | + | NZ_LT906444.1 | Listeria welshimeri |
| 286 | 1208627 | 1208887 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 287 | 1188032 | 1188289 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 288 | 1181338 | 1181625 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 289 | 3185121 | 3185375 | + | NZ_LR134406.1 | Arachnia propionica |
| 290 | 3178170 | 3178430 | + | NZ_LR134406.1 | Arachnia propionica |
| 291 | 24029 | 24289 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 292 | 4063675 | 4063965 | - | NZ_CP036259.1 | Sporomusa termitida |
| 293 | 4080226 | 4080498 | - | NZ_CP036259.1 | Sporomusa termitida |
| 294 | 4080545 | 4080796 | - | NZ_CP036259.1 | Sporomusa termitida |
| 295 | 1956721 | 1956990 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 296 | 1956350 | 1956625 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 297 | 3543637 | 3543912 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 298 | 3543272 | 3543541 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 299 | 4321557 | 4321826 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 300 | 1297954 | 1298223 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 301 | 4321186 | 4321461 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 302 | 1298319 | 1298594 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 303 | 896329 | 896571 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 304 | 896007 | 896279 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 305 | 895737 | 895976 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 306 | 1919473 | 1919733 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 307 | 3264323 | 3264583 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 308 | 3268223 | 3268462 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 309 | 2498366 | 2498605 | - | NZ_CP011254.1 | Serratia fonticola |
| 310 | 2498659 | 2498904 | - | NZ_CP011254.1 | Serratia fonticola |
| 311 | 2498968 | 2499207 | - | NZ_CP011254.1 | Serratia fonticola |
| 312 | 1596692 | 1596937 | + | NZ_CP043405.1 | Streptococcus ratti |
| 313 | 1596975 | 1597226 | + | NZ_CP043405.1 | Streptococcus ratti |
| 314 | 1834784 | 1835056 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 315 | 1841662 | 1841943 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 316 | 2277268 | 2277528 | - | NZ_LS483250.1 | Moritella yayanosii |
| 317 | 2277555 | 2277821 | - | NZ_LS483250.1 | Moritella yayanosii |
| 318 | 299958 | 300218 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 319 | 3940078 | 3940335 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 320 | 4692122 | 4692379 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 321 | 3395754 | 3396014 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 322 | 3400731 | 3400970 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 323 | 3891459 | 3891713 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 324 | 5555626 | 5555877 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 325 | 5562479 | 5562742 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 326 | 1688711 | 1688974 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 327 | 1709490 | 1709750 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 328 | 1716279 | 1716521 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 329 | 2349643 | 2349903 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 330 | 1497336 | 1497578 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 331 | 1490604 | 1490867 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 332 | 2594804 | 2595046 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 333 | 2593493 | 2593762 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 334 | 120254 | 120532 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 335 | 127151 | 127465 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 336 | 1992139 | 1992402 | - | NZ_CP019870.1 | Clostridioides difficile |
| 337 | 2507517 | 2507777 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 338 | 86671 | 86922 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 339 | 2012605 | 2012844 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 340 | 2028121 | 2028360 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 341 | 2013243 | 2013482 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 342 | 2012924 | 2013163 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 343 | 4083254 | 4083529 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 344 | 4082931 | 4083206 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 345 | 4581653 | 4581901 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 346 | 4579999 | 4580262 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 347 | 3346797 | 3347057 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 348 | 137142 | 137396 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 349 | 130486 | 130758 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 350 | 298753 | 299022 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 351 | 808560 | 808817 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 352 | 807942 | 808181 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 353 | 5115968 | 5116234 | - | NZ_CP026363.1 | Brevibacillus agri |
| 354 | 854406 | 854666 | + | NZ_CP026363.1 | Brevibacillus agri |
| 355 | 5116926 | 5117204 | - | NZ_CP026363.1 | Brevibacillus agri |
| 356 | 101848 | 102105 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 357 | 95091 | 95339 | + | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 358 | 1567040 | 1567279 | - | NZ_CP029256.1 | Christensenella minuta |
| 359 | 1566747 | 1567025 | - | NZ_CP029256.1 | Christensenella minuta |
| 360 | 333034 | 333285 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 361 | 329017 | 329295 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 362 | 483769 | 484029 | + | NZ_CP030280.1 | Blautia argi |
| 363 | 483449 | 483712 | + | NZ_CP030280.1 | Blautia argi |
| 364 | 1748547 | 1748807 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 365 | 2917376 | 2917636 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 366 | 1645012 | 1645302 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 367 | 1630920 | 1631192 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 368 | 2780483 | 2780758 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 369 | 2780814 | 2781089 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 370 | 2319898 | 2320182 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 371 | 2318221 | 2318469 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 372 | 2034393 | 2034632 | - | NZ_CP065640.1 | Serratia rubidaea |
| 373 | 2034993 | 2035232 | - | NZ_CP065640.1 | Serratia rubidaea |
| 374 | 6298918 | 6299160 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 375 | 4376352 | 4376612 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 376 | 4498481 | 4498747 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 377 | 1075433 | 1075678 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 378 | 208679 | 208957 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 379 | 215844 | 216119 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 380 | 733815 | 734057 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 381 | 728163 | 728420 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 382 | 2085171 | 2085461 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 383 | 2101694 | 2101933 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 384 | 1785793 | 1786044 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 385 | 1786130 | 1786396 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 386 | 562813 | 563052 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 387 | 843691 | 843930 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 388 | 1099427 | 1099684 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 389 | 1968769 | 1969026 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 390 | 1970298 | 1970573 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 391 | 1891651 | 1891917 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 392 | 3119348 | 3119608 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 393 | 2563463 | 2563738 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 394 | 879371 | 879610 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 395 | 420531 | 420776 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 396 | 421539 | 421778 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 397 | 5945468 | 5945743 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 398 | 5946124 | 5946399 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 399 | 5945799 | 5946074 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 400 | 2425971 | 2426234 | + | NZ_CP032487.1 | Yersinia hibernica |
| 401 | 2419626 | 2419871 | + | NZ_CP032487.1 | Yersinia hibernica |
| 402 | 19243 | 19503 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 403 | 32172 | 32435 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 404 | 29989 | 30267 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 405 | 520519 | 520779 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 406 | 524477 | 524740 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 407 | 451189 | 451506 | - | NC_008826.1 | Methylibium petroleiphilum PM1 |
| 408 | 1186266 | 1186508 | + | NZ_CP033433.1 | Cohnella candidum |
| 409 | 2375064 | 2375342 | - | NZ_LR134531.1 | Pragia fontium |
| 410 | 2375355 | 2375603 | - | NZ_LR134531.1 | Pragia fontium |
| 411 | 2375664 | 2375942 | - | NZ_LR134531.1 | Pragia fontium |
| 412 | 2548905 | 2549147 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 413 | 2554758 | 2554997 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 414 | 1708777 | 1709064 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 415 | 554051 | 554338 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 416 | 1527286 | 1527549 | - | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 417 | 1520402 | 1520680 | - | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 418 | 2814088 | 2814348 | + | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 419 | 2821003 | 2821281 | + | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 420 | 864898 | 865152 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 421 | 866471 | 866728 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 422 | 867690 | 867977 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 423 | 314697 | 314957 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 424 | 2003934 | 2004191 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 425 | 919410 | 919676 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 426 | 2010655 | 2010912 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 427 | 919784 | 920044 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 428 | 2716109 | 2716363 | + | NZ_CP039126.1 | Blautia producta |
| 429 | 2682930 | 2683190 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 430 | 2675932 | 2676189 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 431 | 3545957 | 3546244 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 432 | 1391216 | 1391479 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 433 | 3561117 | 3561356 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 434 | 3563319 | 3563570 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 435 | 766289 | 766549 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 436 | 773305 | 773562 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 437 | 563593 | 563871 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 438 | 379741 | 380001 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 439 | 1268866 | 1269105 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 440 | 1262201 | 1262461 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 441 | 46472 | 46762 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 442 | 61410 | 61700 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 443 | 61738 | 61983 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 444 | 2090195 | 2090479 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 445 | 1697037 | 1697309 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 446 | 1703855 | 1704133 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 447 | 4556289 | 4556528 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 448 | 4555696 | 4555935 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 449 | 4555992 | 4556237 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 450 | 4575389 | 4575628 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 451 | 4574796 | 4575035 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 452 | 4575092 | 4575337 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 453 | 929938 | 930213 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 454 | 936134 | 936397 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 455 | 4867097 | 4867336 | + | NZ_CP054254.1 | Klebsiella variicola |
| 456 | 4866504 | 4866743 | + | NZ_CP054254.1 | Klebsiella variicola |
| 457 | 4866800 | 4867045 | + | NZ_CP054254.1 | Klebsiella variicola |
| 458 | 941945 | 942220 | - | NZ_CP054254.1 | Klebsiella variicola |
| 459 | 948146 | 948409 | - | NZ_CP054254.1 | Klebsiella variicola |
| 460 | 1362705 | 1362980 | + | NZ_CP054254.1 | Klebsiella variicola |
| 461 | 354414 | 354656 | + | NC_014363.1 | Olsenella uli DSM 7084 |
| 462 | 355033 | 355272 | + | NC_014363.1 | Olsenella uli DSM 7084 |
| 463 | 354054 | 354293 | + | NC_014363.1 | Olsenella uli DSM 7084 |
| 464 | 1873083 | 1873346 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 465 | 206707 | 206967 | + | NZ_CP028271.1 | Mixta intestinalis |
| 466 | 769085 | 769348 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 467 | 2559990 | 2560229 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 468 | 2560283 | 2560528 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 469 | 1209594 | 1209842 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 470 | 1429196 | 1429435 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 471 | 1429489 | 1429734 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 472 | 2857370 | 2857609 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 473 | 2857071 | 2857316 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 474 | 4596788 | 4597027 | + | NZ_CP041247.1 | Raoultella electrica |
| 475 | 2090863 | 2091123 | - | NZ_CP041247.1 | Raoultella electrica |
| 476 | 4596489 | 4596734 | + | NZ_CP041247.1 | Raoultella electrica |
| 477 | 2403074 | 2403313 | - | NZ_CP026047.1 | Raoultella planticola |
| 478 | 5079411 | 5079671 | + | NZ_CP026047.1 | Raoultella planticola |
| 479 | 2403367 | 2403612 | - | NZ_CP026047.1 | Raoultella planticola |
| 480 | 4845599 | 4845838 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 481 | 2188810 | 2189070 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 482 | 4845300 | 4845545 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 483 | 4937691 | 4937930 | + | NZ_CP050508.1 | Raoultella terrigena |
| 484 | 4937392 | 4937637 | + | NZ_CP050508.1 | Raoultella terrigena |
| 485 | 5236298 | 5236537 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 486 | 5235999 | 5236244 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 487 | 1142337 | 1142600 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 488 | 1136023 | 1136295 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 489 | 1619887 | 1620165 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 490 | 1858245 | 1858520 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 491 | 1851910 | 1852173 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 492 | 758893 | 759132 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 493 | 759486 | 759725 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 494 | 759184 | 759429 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 495 | 5334541 | 5334780 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 496 | 5333945 | 5334184 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 497 | 5334241 | 5334486 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 498 | 1048311 | 1048574 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 499 | 1534558 | 1534833 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 500 | 1042115 | 1042390 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 501 | 4206668 | 4206967 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 502 | 725473 | 725715 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 503 | 7167256 | 7167510 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 504 | 4418179 | 4418418 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 505 | 4417584 | 4417823 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 506 | 4417880 | 4418125 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 507 | 2363848 | 2364108 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 508 | 1117604 | 1117882 | - | NZ_CP026364.1 | Proteus hauseri |
| 509 | 1118202 | 1118441 | - | NZ_CP026364.1 | Proteus hauseri |
| 510 | 1117897 | 1118181 | - | NZ_CP026364.1 | Proteus hauseri |
| 511 | 2439905 | 2440165 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 512 | 4629465 | 4629725 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 513 | 1241145 | 1241405 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 514 | 4628681 | 4628923 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 515 | 1037178 | 1037417 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 516 | 1036879 | 1037124 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 517 | 1052113 | 1052376 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 518 | 1058280 | 1058555 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 519 | 3576732 | 3576971 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 520 | 3583583 | 3583822 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 521 | 3491660 | 3491938 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 522 | 3492258 | 3492497 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 523 | 3491953 | 3492237 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 524 | 2971942 | 2972199 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 525 | 2972540 | 2972779 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 526 | 2972235 | 2972480 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 527 | 7987624 | 7987878 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 528 | 1084017 | 1084274 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 529 | 1082153 | 1082425 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 530 | 396517 | 396792 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 531 | 396239 | 396484 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 532 | 1401829 | 1402068 | + | NZ_CP029736.1 | Providencia rettgeri |
| 533 | 1402428 | 1402667 | + | NZ_CP029736.1 | Providencia rettgeri |
| 534 | 1402128 | 1402373 | + | NZ_CP029736.1 | Providencia rettgeri |
| 535 | 988679 | 988921 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 536 | 967460 | 967702 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 537 | 845078 | 845320 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 538 | 2537835 | 2538077 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 539 | 2538126 | 2538383 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 540 | 1774540 | 1774797 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 541 | 1776153 | 1776410 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 542 | 1810542 | 1810799 | - | NZ_LR134375.1 | Veillonella dispar |
| 543 | 1812549 | 1812806 | - | NZ_LR134375.1 | Veillonella dispar |
| 544 | 1480007 | 1480246 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 545 | 1480603 | 1480842 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 546 | 1480264 | 1480548 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 547 | 3717990 | 3718229 | - | NZ_LS483422.1 | Providencia heimbachae |
| 548 | 3717392 | 3717670 | - | NZ_LS483422.1 | Providencia heimbachae |
| 549 | 3717686 | 3717934 | - | NZ_LS483422.1 | Providencia heimbachae |
| 550 | 3170471 | 3170710 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 551 | 3169872 | 3170111 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 552 | 3170166 | 3170411 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 553 | 2179350 | 2179610 | - | NC_008593.1 | Clostridium novyi NT |
| 554 | 2147746 | 2148042 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 555 | 489313 | 489558 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 556 | 1794578 | 1794820 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 557 | 495943 | 496191 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 558 | 500660 | 500929 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 559 | 711379 | 711621 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 560 | 2441378 | 2441623 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 561 | 352901 | 353146 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 562 | 2248974 | 2249216 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 563 | 1687474 | 1687731 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 564 | 8365076 | 8365333 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 565 | 4359714 | 4359953 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 566 | 1322737 | 1322988 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 567 | 1323034 | 1323291 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 568 | 1130838 | 1131080 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 569 | 1591380 | 1591622 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 570 | 1591008 | 1591250 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 571 | 4328959 | 4329198 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 572 | 4322752 | 4323015 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 573 | 4792834 | 4793109 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 574 | 2515858 | 2516097 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 575 | 2522041 | 2522304 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 576 | 1995379 | 1995654 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 577 | 5202242 | 5202481 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 578 | 5197466 | 5197705 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 579 | 2031381 | 2031677 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 580 | 2031107 | 2031364 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 581 | 6166367 | 6166636 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 582 | 2380435 | 2380695 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 583 | 2374237 | 2374500 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 584 | 1467068 | 1467307 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 585 | 593456 | 593698 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 586 | 4592933 | 4593190 | - | NZ_CP043998.1 | Clostridium diolis |
| 587 | 4583687 | 4583944 | - | NZ_CP043998.1 | Clostridium diolis |
| 588 | 5441633 | 5441875 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 589 | 4305567 | 4305842 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 590 | 4299369 | 4299632 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 591 | 3891822 | 3892097 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 592 | 2224940 | 2225185 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 593 | 2527116 | 2527391 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 594 | 2231135 | 2231374 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 595 | 1031632 | 1031892 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 596 | 1025434 | 1025697 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 597 | 1751285 | 1751527 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 598 | 2123041 | 2123316 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 599 | 2116864 | 2117127 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 600 | 2575211 | 2575486 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 601 | 1257829 | 1258071 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 602 | 4326930 | 4327190 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 603 | 3847675 | 3847953 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 604 | 4320734 | 4321009 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 605 | 773757 | 774017 | + | NZ_CP033744.1 | Citrobacter freundii |
| 606 | 1252512 | 1252790 | - | NZ_CP033744.1 | Citrobacter freundii |
| 607 | 779938 | 780213 | + | NZ_CP033744.1 | Citrobacter freundii |
| 608 | 1935846 | 1936088 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 609 | 2617694 | 2617957 | + | NZ_LR134340.1 | Escherichia marmotae |
| 610 | 3106780 | 3107058 | - | NZ_LR134340.1 | Escherichia marmotae |
| 611 | 2623862 | 2624137 | + | NZ_LR134340.1 | Escherichia marmotae |
| 612 | 2041944 | 2042207 | + | NZ_AP014857.1 | Escherichia albertii |
| 613 | 2540244 | 2540522 | - | NZ_AP014857.1 | Escherichia albertii |
| 614 | 2048112 | 2048387 | + | NZ_AP014857.1 | Escherichia albertii |
| 615 | 1509418 | 1509663 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 616 | 1509060 | 1509305 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 617 | 3219035 | 3219280 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 618 | 3219388 | 3219633 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 619 | 2838513 | 2838776 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 620 | 3314534 | 3314812 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 621 | 2844681 | 2844956 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 622 | 768330 | 768593 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 623 | 328064 | 328339 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 624 | 762137 | 762412 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 625 | 1003765 | 1004010 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 626 | 532811 | 533053 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 627 | 821680 | 821934 | - | NZ_CP047476.1 | Vibrio astriarenae |
| 628 | 484492 | 484752 | - | NZ_CP038469.1 | Citrobacter tructae |
| 629 | 4790585 | 4790863 | + | NZ_CP038469.1 | Citrobacter tructae |
| 630 | 478296 | 478571 | - | NZ_CP038469.1 | Citrobacter tructae |
| 631 | 815967 | 816209 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 632 | 320637 | 320915 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 633 | 6182468 | 6182713 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 634 | 1794384 | 1794623 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 635 | 599389 | 599634 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 636 | 773420 | 773662 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 637 | 375107 | 375352 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 638 | 374742 | 374987 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 639 | 3918312 | 3918554 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 640 | 3398068 | 3398310 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 641 | 5379082 | 5379324 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 642 | 4310116 | 4310358 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 643 | 3045350 | 3045607 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 644 | 1684165 | 1684407 | - | NZ_CP046293.1 | Yersinia intermedia |
| 645 | 625698 | 625976 | + | NZ_CP046293.1 | Yersinia intermedia |
| 646 | 1677696 | 1677971 | - | NZ_CP046293.1 | Yersinia intermedia |
| 647 | 2979977 | 2980240 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 648 | 2986344 | 2986604 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 649 | 5221938 | 5222261 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 650 | 5212323 | 5212592 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 651 | 4395970 | 4396215 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 652 | 7132330 | 7132593 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 653 | 7129217 | 7129468 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 654 | 4409100 | 4409372 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 655 | 4402669 | 4402944 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 656 | 3036575 | 3036832 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 657 | 3042905 | 3043180 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 658 | 1124594 | 1124899 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 659 | 1117446 | 1117691 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 660 | 3884118 | 3884381 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 661 | 3886104 | 3886370 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 662 | 2982600 | 2982860 | + | NZ_CP043727.1 | Yersinia canariae |
| 663 | 2988936 | 2989211 | + | NZ_CP043727.1 | Yersinia canariae |
| 664 | 1940867 | 1941127 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 665 | 1942400 | 1942654 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 666 | 543511 | 543786 | - | NZ_CP053416.1 | Salmonella bongori |
| 667 | 2572157 | 2572435 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 668 | 3288488 | 3288766 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 669 | 1913136 | 1913414 | + | NZ_CP050150.1 | Hafnia alvei |
| 670 | 5930654 | 5930911 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 671 | 699795 | 700049 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 672 | 699433 | 699687 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 673 | 4739913 | 4740206 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 674 | 5020452 | 5020700 | + | NZ_CP016211.1 | Minicystis rosea |
| 675 | 1398664 | 1398933 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 676 | 757436 | 757675 | + | NZ_CP036281.1 | Polystyrenella longa |
| 677 | 757843 | 758115 | + | NZ_CP036281.1 | Polystyrenella longa |
| 678 | 5885620 | 5885949 | - | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 679 | 333520 | 333798 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 680 | 333819 | 334076 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 681 | 3438650 | 3438928 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 682 | 3441287 | 3441532 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 683 | 3430708 | 3430986 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 684 | 3433359 | 3433604 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 685 | 695265 | 695525 | + | NZ_LR778174.1 | Veillonella parvula |
| 686 | 702840 | 703091 | + | NZ_LR778174.1 | Veillonella parvula |
| 687 | 2586811 | 2587131 | - | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 688 | 2578883 | 2579188 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 689 | 622566 | 622808 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 690 | 2224125 | 2224454 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 691 | 2216364 | 2216633 | + | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 692 | 457828 | 458106 | + | NC_014633.1 | Ilyobacter polytropus DSM 2926 |
| 693 | 3034367 | 3034642 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 694 | 6831779 | 6832093 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 695 | 6832098 | 6832352 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 696 | 6831447 | 6831725 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 697 | 5854474 | 5854746 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 698 | 5854802 | 5855053 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 699 | 5854138 | 5854422 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 700 | 4971082 | 4971324 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
| 701 | 2756803 | 2757045 | - | NZ_CP034348.1 | Roseovarius faecimaris |
| 702 | 298065 | 298352 | - | NZ_CP063458.1 | Humisphaera borealis |
| 703 | 296424 | 296669 | - | NZ_CP063458.1 | Humisphaera borealis |
| 704 | 2207847 | 2208104 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 705 | 2208172 | 2208501 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 706 | 2207473 | 2207760 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 707 | 1601795 | 1602049 | + | NC_010571.1 | Opitutus terrae PB90-1 |
| 708 | 3800801 | 3801076 | - | NC_014624.2 | Eubacterium callanderi |
| 709 | 2207469 | 2207744 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 710 | 1334860 | 1335135 | + | NZ_CP019962.1 | Eubacterium limosum |
| 711 | 5046681 | 5046950 | + | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 712 | 5046345 | 5046605 | + | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 713 | 136984 | 137265 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 714 | 1346106 | 1346345 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 715 | 119132 | 119440 | - | NZ_CP061725.1 | Micromonospora craniellae |
| 716 | 2950036 | 2950305 | - | NZ_CP036276.1 | Symmachiella dynata |
| 717 | 2950376 | 2950624 | - | NZ_CP036276.1 | Symmachiella dynata |
| 718 | 4708034 | 4708303 | + | NZ_CP043930.1 | Gimesia benthica |
| 719 | 6391662 | 6391928 | + | NZ_CP036353.1 | Gimesia maris |
| 720 | 2276504 | 2276773 | - | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 721 | 2276963 | 2277226 | - | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 722 | 332361 | 332618 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 723 | 1834281 | 1834541 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 724 | 1912122 | 1912382 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 725 | 5951290 | 5951550 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 726 | 2265214 | 2265456 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 727 | 2267025 | 2267300 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 728 | 2266716 | 2266961 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 729 | 1370396 | 1370656 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 730 | 3253973 | 3254242 | - | NZ_CP036299.1 | Planctopirus ephydatiae |
| 731 | 3254432 | 3254695 | - | NZ_CP036299.1 | Planctopirus ephydatiae |
| 732 | 4253929 | 4254189 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 733 | 172479 | 172739 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 734 | 743810 | 744052 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 735 | 2308815 | 2309054 | + | NZ_CP024422.1 | Paracoccus yeei |
| 736 | 2650320 | 2650562 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 737 | 4597198 | 4597479 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 738 | 4221313 | 4221552 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 739 | 5712618 | 5712878 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 740 | 2019931 | 2020191 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 741 | 4167109 | 4167390 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 742 | 4695361 | 4695600 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 743 | 318157 | 318396 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 744 | 5567238 | 5567498 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 745 | 1562631 | 1562912 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 746 | 7284378 | 7284659 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 747 | 1988967 | 1989206 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 748 | 252763 | 253002 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 749 | 838383 | 838622 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 750 | 1711642 | 1711881 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 751 | 4276813 | 4277052 | - | NZ_CP035503.1 | Rhodoferax sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046415.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00936.21 | 0.97 | 340 | 340 | same-strand | BMC domain |
| 2 | PF03319.15 | 0.88 | 309 | 915 | same-strand | Ethanolamine utilisation protein EutN/carboxysome |
++ More..