Result : P45611
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphocarrier protein HPr (Histidine-containing protein) |
| NCBI Accession ID | L22432.1 |
| Organism | Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) |
| Left | 617 |
| Right | 886 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAGTTTTCAGCTATCATTACAGATAAAGTAGGATTACATGCAAGACCAGCTTCAGTACTAGCTAAAGAAGCTTCTAAATTTAGTTCAAACATTACTATAATAGCAAATGAAAAACAAGGTAATTTAAAATCAATTATGAATGTAATGGCAATGGCTATAAAAACTGGAACCGAAATAACTATTCAAGCTGATGGAAATGATGCTGATCAAGCAATACAAGCAATCAAACAAACTATGATTGATACAGCTTTAATACAAGGATAA |
| Sequence | MAKFSAIITDKVGLHARPASVLAKEASKFSSNITIIANEKQGNLKSIMNVMAMAIKTGTEITIQADGNDADQAIQAIKQTMIDTALIQG |
| Source of smORF | Swiss-Prot |
| Function | General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain.; P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity (By similarity). {ECO:0000250}. |
| Pubmed ID | 8253782 8710835 7582895 |
| Domain | CDD:412221 |
| Functional Category | Others |
| Uniprot ID | P45611 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 831735 | 832004 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 834204 | 834473 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 219309 | 219578 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 4 | 720005 | 720274 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 5 | 732291 | 732560 | - | NZ_CP024965.1 | Entomoplasma somnilux |
| 6 | 787544 | 787810 | - | NZ_CP025257.1 | Mesoplasma syrphidae |
| 7 | 47370 | 47639 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 8 | 156501 | 156764 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 9 | 591314 | 591589 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 10 | 728598 | 728867 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 11 | 1437527 | 1437790 | - | NZ_CP024870.1 | Spiroplasma clarkii |
| 12 | 123998 | 124261 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 13 | 113827 | 114090 | + | NZ_CP017015.1 | Spiroplasma helicoides |
| 14 | 100721 | 100984 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 15 | 106300 | 106563 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 16 | 111084 | 111347 | + | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 17 | 99164 | 99427 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 18 | 701975 | 702244 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 19 | 129679 | 129942 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 20 | 201858 | 202121 | + | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 21 | 713975 | 714244 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 22 | 657113 | 657382 | - | NC_006055.1 | Mesoplasma florum L1 |
| 23 | 109060 | 109323 | + | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 24 | 104186 | 104449 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 25 | 707108 | 707377 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 26 | 702401 | 702670 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 27 | 102029 | 102292 | + | NZ_CP012328.1 | Spiroplasma turonicum |
| 28 | 101649 | 101912 | + | NZ_CP022535.1 | Spiroplasma corruscae |
| 29 | 113566 | 113829 | + | NC_022998.1 | Spiroplasma apis B31 |
| 30 | 99074 | 99337 | + | NZ_CP012357.1 | Spiroplasma litorale |
| 31 | 720083 | 720346 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 32 | 289696 | 289959 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 33 | 316050 | 316313 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 34 | 335376 | 335639 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 35 | 795941 | 796210 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 36 | 243814 | 244077 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 37 | 986656 | 986919 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 38 | 341531 | 341794 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 39 | 311217 | 311486 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 40 | 49376 | 49642 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 41 | 455564 | 455830 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 42 | 5176731 | 5177000 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 43 | 181685 | 181954 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 44 | 7235081 | 7235350 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 45 | 760664 | 760933 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 46 | 188863 | 189126 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 47 | 2088147 | 2088416 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 48 | 173398 | 173667 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 49 | 2044738 | 2045007 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 50 | 179008 | 179277 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 51 | 1852241 | 1852510 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 52 | 171789 | 172058 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 53 | 174916 | 175185 | + | NZ_CP009288.1 | Paenibacillus durus |
| 54 | 168342 | 168611 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 55 | 1298930 | 1299196 | - | NZ_CP061835.1 | Weissella viridescens |
| 56 | 218778 | 219047 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 57 | 799567 | 799836 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 58 | 1720850 | 1721119 | + | NZ_CP059540.1 | Planococcus maritimus |
| 59 | 1708659 | 1708928 | + | NZ_CP016538.2 | Planococcus maritimus |
| 60 | 104078 | 104350 | + | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 61 | 831903 | 832172 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 62 | 1074742 | 1075008 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 63 | 1766560 | 1766826 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 64 | 1858145 | 1858411 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 65 | 1180393 | 1180656 | + | NZ_CP012024.1 | Bacillus smithii |
| 66 | 1464120 | 1464389 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 67 | 642143 | 642409 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 68 | 1696298 | 1696567 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 69 | 318175 | 318441 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 70 | 1058136 | 1058402 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 71 | 1955731 | 1955997 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 72 | 686115 | 686354 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 73 | 1147056 | 1147295 | - | NC_012924.1 | Streptococcus suis SC84 |
| 74 | 1464282 | 1464521 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 75 | 890913 | 891152 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 76 | 1256184 | 1256423 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 77 | 1354462 | 1354701 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 78 | 743383 | 743649 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 79 | 429209 | 429475 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
++ More..