Result : P45505
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative protein YfaH |
| NCBI Accession ID | AP009048.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 2354357 |
| Right | 2354563 |
| Strand | + |
| Nucleotide Sequence | ATGAATTTTATTCGACAGGGATTAGGCATCGCCTTACAACCAGAGTTAACGCTGAAAAGCATTGCAGGTGAATTGTGTTCCGTTCCTCTCGAACCAACTTTCTATCGACAGATTTCGTTGCTGGCTAAAGAAAAGCCGGTAGAAGGCAGTCCACTGTTTTTACTACAAATGTGCATGGAACAATTAGTGGCGATTGGAAAAATTTGA |
| Sequence | MNFIRQGLGIALQPELTLKSIAGELCSVPLEPTFYRQISLLAKEKPVEGSPLFLLQMCMEQLVAIGKI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK09729. Profile Description: hypothetical protein; Provisional |
| Pubmed ID | 6087316 9205837 9278503 16738553 7567469 |
| Domain | CDD:182050 |
| Functional Category | Others |
| Uniprot ID | P45505 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2349687 | 2349893 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2366440 | 2366646 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2387243 | 2387413 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 4 | 365547 | 365717 | + | NZ_CP053416.1 | Salmonella bongori |
| 5 | 4018364 | 4018570 | - | NZ_CP044098.1 | Citrobacter portucalensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02867.17 | 1.0 | 5 | 3522 | same-strand | Ribonucleotide reductase, barrel domain |
| 2 | PF03477.18 | 1.0 | 5 | 3522 | same-strand | ATP cone domain |
| 3 | PF00317.23 | 1.0 | 5 | 3522 | same-strand | Ribonucleotide reductase, all-alpha domain |
| 4 | PF00268.23 | 1.0 | 5 | 2281 | same-strand | Ribonucleotide reductase, small chain |
| 5 | PF00111.29 | 1.0 | 5 | 2027 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 6 | PF03009.19 | 1.0 | 5 | 62 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
| 7 | PF07690.18 | 1.0 | 5 | 1123.0 | opposite-strand | Major Facilitator Superfamily |
| 8 | PF01266.26 | 1.0 | 5 | 2762 | same-strand | FAD dependent oxidoreductase |
| 9 | PF04324.17 | 1.0 | 5 | 2762 | same-strand | BFD-like [2Fe-2S] binding domain |
| 10 | PF16901.7 | 1.0 | 5 | 2762 | same-strand | C-terminal domain of alpha-glycerophosphate oxidase |
| 11 | PF00890.26 | 1.0 | 5 | 4380 | same-strand | FAD binding domain |
| 12 | PF02754.18 | 1.0 | 5 | 5636 | same-strand | Cysteine-rich domain |
| 13 | PF13183.8 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
| 14 | PF13534.8 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
| 15 | PF12838.9 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
| 16 | PF08241.14 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |
| 17 | PF13649.8 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |
| 18 | PF08242.14 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |
++ More..