Protein Information |
Information Type | Description |
---|---|
Protein name | Putative protein YfaH |
NCBI Accession ID | AP009048.1 |
Organism | Escherichia coli (strain K12) |
Left | 2354357 |
Right | 2354563 |
Strand | + |
Nucleotide Sequence | ATGAATTTTATTCGACAGGGATTAGGCATCGCCTTACAACCAGAGTTAACGCTGAAAAGCATTGCAGGTGAATTGTGTTCCGTTCCTCTCGAACCAACTTTCTATCGACAGATTTCGTTGCTGGCTAAAGAAAAGCCGGTAGAAGGCAGTCCACTGTTTTTACTACAAATGTGCATGGAACAATTAGTGGCGATTGGAAAAATTTGA |
Sequence | MNFIRQGLGIALQPELTLKSIAGELCSVPLEPTFYRQISLLAKEKPVEGSPLFLLQMCMEQLVAIGKI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of PRK09729. Profile Description: hypothetical protein; Provisional |
Pubmed ID | 6087316 9205837 9278503 16738553 7567469 |
Domain | CDD:182050 |
Functional Category | Others |
Uniprot ID | P45505 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2349687 | 2349893 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2366440 | 2366646 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 2387243 | 2387413 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
4 | 365547 | 365717 | + | NZ_CP053416.1 | Salmonella bongori |
5 | 4018364 | 4018570 | - | NZ_CP044098.1 | Citrobacter portucalensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02867.17 | 1.0 | 5 | 3522 | same-strand | Ribonucleotide reductase, barrel domain |
2 | PF03477.18 | 1.0 | 5 | 3522 | same-strand | ATP cone domain |
3 | PF00317.23 | 1.0 | 5 | 3522 | same-strand | Ribonucleotide reductase, all-alpha domain |
4 | PF00268.23 | 1.0 | 5 | 2281 | same-strand | Ribonucleotide reductase, small chain |
5 | PF00111.29 | 1.0 | 5 | 2027 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
6 | PF03009.19 | 1.0 | 5 | 62 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
7 | PF07690.18 | 1.0 | 5 | 1123.0 | opposite-strand | Major Facilitator Superfamily |
8 | PF01266.26 | 1.0 | 5 | 2762 | same-strand | FAD dependent oxidoreductase |
9 | PF04324.17 | 1.0 | 5 | 2762 | same-strand | BFD-like [2Fe-2S] binding domain |
10 | PF16901.7 | 1.0 | 5 | 2762 | same-strand | C-terminal domain of alpha-glycerophosphate oxidase |
11 | PF00890.26 | 1.0 | 5 | 4380 | same-strand | FAD binding domain |
12 | PF02754.18 | 1.0 | 5 | 5636 | same-strand | Cysteine-rich domain |
13 | PF13183.8 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
14 | PF13534.8 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
15 | PF12838.9 | 1.0 | 5 | 5636 | same-strand | 4Fe-4S dicluster domain |
16 | PF08241.14 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |
17 | PF13649.8 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |
18 | PF08242.14 | 0.6 | 3 | 6209 | same-strand | Methyltransferase domain |