Result : P45453
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Competence pheromone |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3255853 |
| Right | 3256020 |
| Strand | - |
| Nucleotide Sequence | ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGGTTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGGGTGATTAA |
| Sequence | MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD |
| Source of smORF | Swiss-Prot |
| Function | Part of a major quorum-sensing system that regulates the development of genetic competence. Acts through the activation of the two-component regulatory system ComP/ComA composed of a sensor histidine kinase, ComP, and a response regulator, ComA, that regulates directly the transcription of over 20 genes. Transport through the membrane may involve Spo0K. Under certain conditions plays a role in sporulation. {ECO:0000269|Pubmed:16091051}. |
| Pubmed ID | 2116363 9384377 8168130 11133937 12067344 14679219 16091051 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P45453 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3255853 | 3256020 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3042639 | 3042806 | - | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03334.16 | 1.0 | 2 | 3489.5 | opposite-strand | Na+/H+ antiporter subunit |
| 2 | PF03061.24 | 1.0 | 2 | 3070.5 | same-strand | Thioesterase superfamily |
| 3 | PF00072.26 | 1.0 | 2 | 2408.0 | same-strand | Response regulator receiver domain |
| 4 | PF00196.21 | 1.0 | 2 | 2408.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 5 | PF07730.15 | 1.0 | 2 | 480.0 | same-strand | Histidine kinase |
| 6 | PF02518.28 | 1.0 | 2 | 480.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF08181.13 | 1.0 | 2 | 1071.5 | same-strand | DegQ (SacQ) family |
| 8 | PF17767.3 | 1.0 | 2 | 3382.0 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 9 | PF17956.3 | 1.0 | 2 | 3382.0 | same-strand | Nicotinate phosphoribosyltransferase C-terminal domain |
| 10 | PF04095.18 | 1.0 | 2 | 3382.0 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) family |
++ More..