Result : P45408
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Heme exporter protein D (Cytochrome c-type biogenesis protein CycX) |
| NCBI Accession ID | X79307.1 |
| Organism | Rhizobium leguminosarum bv. viciae |
| Left | 153 |
| Right | 317 |
| Strand | + |
| Nucleotide Sequence | GTGACGCATGCCTTCTACGCCTACGCCTCCTATGGCTTCGCGGCCCTGGTGACGATCGCCGTCACCGTCTGGACCTGGGCCGACGCGCGCCGTCGCCGGGAACTTGCAGCCCTTGAGGCCGCCGGTATCCGCCGCGCTCGGCCGCGCGCAAGGGACGGCGAATGA |
| Sequence | MTHAFYAYASYGFAALVTIAVTVWTWADARRRRELAALEAAGIRRARPRARDGE |
| Source of smORF | Swiss-Prot |
| Function | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. {ECO:0000305}. |
| Pubmed ID | 8021193 |
| Domain | CDD:416290 |
| Functional Category | Others |
| Uniprot ID | P45408 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4319657 | 4319824 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 2 | 4093515 | 4093682 | + | NZ_CP020906.1 | Rhizobium etli |
| 3 | 4267656 | 4267823 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 4 | 2918106 | 2918285 | - | NZ_CP054021.1 | Rhizobium indicum |
| 5 | 1599905 | 1600072 | + | NZ_CP071454.1 | Rhizobium lentis |
| 6 | 210095 | 210262 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 7 | 3921807 | 3921974 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 8 | 4300176 | 4300343 | + | NZ_CP071604.1 | Rhizobium binae |
| 9 | 4800925 | 4801104 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 10 | 4164424 | 4164591 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 11 | 3919236 | 3919403 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 12 | 4121454 | 4121627 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 13 | 273164 | 273334 | - | NZ_CP041239.1 | Ensifer mexicanus |
| 14 | 3464354 | 3464527 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 15 | 1263931 | 1264107 | + | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 16 | 3557354 | 3557527 | + | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 17 | 3790552 | 3790722 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 18 | 3516651 | 3516824 | - | NZ_CP015880.1 | Ensifer adhaerens |
| 19 | 3453638 | 3453811 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 20 | 3466883 | 3467056 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 21 | 3627599 | 3627772 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 22 | 4545679 | 4545840 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 23 | 2404608 | 2404781 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 24 | 3629935 | 3630108 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 25 | 3519112 | 3519285 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013532.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06764.13 | 0.72 | 18 | 5408.0 | opposite-strand | Protein of unknown function (DUF1223) |
| 2 | PF00330.22 | 0.92 | 23 | 2461 | opposite-strand | Aconitase family (aconitate hydratase) |
| 3 | PF00694.21 | 0.92 | 23 | 2461 | opposite-strand | Aconitase C-terminal domain |
| 4 | PF00005.29 | 0.92 | 23 | 1526 | same-strand | ABC transporter |
| 5 | PF03379.15 | 0.96 | 24 | 813.5 | same-strand | CcmB protein |
| 6 | PF01578.22 | 0.92 | 23 | 4.0 | same-strand | Cytochrome C assembly protein |
| 7 | PF08534.12 | 0.88 | 22 | -3 | same-strand | Redoxin |
| 8 | PF00578.23 | 0.92 | 23 | -3.0 | same-strand | AhpC/TSA family |
| 9 | PF13905.8 | 1.0 | 25 | -3 | same-strand | Thioredoxin-like |
| 10 | PF10755.11 | 0.8 | 20 | 650.5 | opposite-strand | Protein of unknown function (DUF2585) |
| 11 | PF04279.17 | 0.88 | 22 | 1229.5 | opposite-strand | Intracellular septation protein A |
| 12 | PF00448.24 | 0.88 | 22 | 1950.5 | opposite-strand | SRP54-type protein, GTPase domain |
| 13 | PF02881.21 | 0.88 | 22 | 1950.5 | opposite-strand | SRP54-type protein, helical bundle domain |
| 14 | PF13401.8 | 0.88 | 22 | 1950.5 | opposite-strand | AAA domain |
| 15 | PF04055.23 | 0.8 | 20 | 3529.5 | opposite-strand | Radical SAM superfamily |
| 16 | PF00919.22 | 0.8 | 20 | 3529.5 | opposite-strand | Uncharacterized protein family UPF0004 |
++ More..