Result : P45309
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Molybdopterin synthase sulfur carrier subunit (MPT synthase subunit 1) (Molybdenum cofactor biosynthesis protein D) (Molybdopterin-converting factor small subunit) (Molybdopterin-converting factor subunit 1) (Sulfur carrier protein MoaD) |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1743403 |
| Right | 1743648 |
| Strand | - |
| Nucleotide Sequence | ATGTTAAATGTTTTATTTTTTGCTCAAACTCGTGAATTAATTGGCGTTGATGCCATTCAATTAGAAGATGATTTTGCCACTGCGGAAGCGGTGCGTGAACACCTTGCTCAAAAGGGCGATAAATGGGCATTGGCACTGGAAAAAGGTAAACTTTTAGTGGCAATTAATCAAACCTTAATGCCTTTAGAAAGTGCGGTAAAAAATGGCGATGAAATTGCCTTTTTCCCACCAGTAACAGGGGGCTAA |
| Sequence | MLNVLFFAQTRELIGVDAIQLEDDFATAEAVREHLAQKGDKWALALEKGKLLVAINQTLMPLESAVKNGDEIAFFPPVTGG |
| Source of smORF | Swiss-Prot |
| Function | Involved in sulfur transfer in the conversion of molybdopterin precursor Z to molybdopterin. {ECO:0000250}. |
| Pubmed ID | 7542800 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | P45309 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 259
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1741933 | 1742178 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 1188581 | 1188826 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 1619889 | 1620134 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1518684 | 1518929 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 5 | 932213 | 932458 | + | NZ_CP018804.1 | Histophilus somni |
| 6 | 1683767 | 1684012 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 7 | 793394 | 793639 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 8 | 1176946 | 1177191 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 9 | 386261 | 386506 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 10 | 2083803 | 2084048 | + | NZ_CP028926.1 | Pasteurella multocida |
| 11 | 804873 | 805118 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 12 | 746329 | 746574 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 13 | 1378141 | 1378386 | + | NZ_LR134167.1 | Avibacterium volantium |
| 14 | 1041301 | 1041546 | - | NZ_CP016604.1 | Otariodibacter oris |
| 15 | 722618 | 722863 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 16 | 1482516 | 1482761 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 17 | 626635 | 626880 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 18 | 1005081 | 1005326 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 19 | 468066 | 468311 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 20 | 1643953 | 1644198 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 21 | 2319017 | 2319262 | + | NZ_CP014056.2 | Grimontia hollisae |
| 22 | 1306592 | 1306837 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 23 | 1077195 | 1077440 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 24 | 1474258 | 1474503 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 25 | 1900994 | 1901239 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 26 | 1427373 | 1427618 | - | NZ_CP046531.1 | Mannheimia ovis |
| 27 | 1663630 | 1663875 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 28 | 3168613 | 3168858 | - | NZ_AP022188.1 | Aeromonas media |
| 29 | 1563668 | 1563913 | - | NZ_CP061280.1 | Mannheimia bovis |
| 30 | 2036275 | 2036520 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 31 | 1292675 | 1292920 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 32 | 2367221 | 2367466 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 33 | 1295879 | 1296124 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 34 | 1513146 | 1513391 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 35 | 2027374 | 2027619 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 36 | 2318341 | 2318586 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 37 | 1769535 | 1769780 | - | NZ_CP044060.1 | Aeromonas veronii |
| 38 | 61688 | 61933 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 39 | 4171832 | 4172077 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 40 | 1247646 | 1247891 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 41 | 1391091 | 1391336 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 42 | 2014551 | 2014796 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 43 | 2653772 | 2654017 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 44 | 2183512 | 2183757 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 45 | 405113 | 405358 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 46 | 2098483 | 2098740 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 47 | 1435126 | 1435371 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 48 | 2749508 | 2749753 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 49 | 1497530 | 1497787 | + | NC_013456.1 | Vibrio antiquarius |
| 50 | 3016516 | 3016761 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 51 | 1853392 | 1853637 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 52 | 2935068 | 2935313 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 53 | 1086283 | 1086528 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 54 | 3173497 | 3173742 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 55 | 3698100 | 3698345 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 56 | 706950 | 707207 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 57 | 1721419 | 1721664 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 58 | 3790846 | 3791094 | - | NZ_CP054254.1 | Klebsiella variicola |
| 59 | 1481200 | 1481445 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 60 | 817023 | 817268 | + | NZ_AP014857.1 | Escherichia albertii |
| 61 | 1829250 | 1829495 | - | NZ_CP033078.1 | Vibrio zhugei |
| 62 | 1511325 | 1511570 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 63 | 1440157 | 1440402 | + | NZ_CP040990.1 | Vibrio furnissii |
| 64 | 2168679 | 2168924 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 65 | 2698197 | 2698442 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 66 | 3353592 | 3353837 | + | NZ_CP053416.1 | Salmonella bongori |
| 67 | 1390431 | 1390676 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 68 | 872645 | 872890 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 69 | 114992 | 115237 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 70 | 2659551 | 2659808 | - | NZ_CP009467.1 | Vibrio harveyi |
| 71 | 941414 | 941659 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 72 | 1020680 | 1020925 | + | NC_011753.2 | Vibrio atlanticus |
| 73 | 2788129 | 2788374 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 74 | 2193261 | 2193518 | - | NZ_CP030788.1 | Vibrio campbellii |
| 75 | 1327331 | 1327576 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 76 | 2845928 | 2846173 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 77 | 819048 | 819293 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 78 | 1069301 | 1069558 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 79 | 1463716 | 1463961 | + | NZ_LR134340.1 | Escherichia marmotae |
| 80 | 761875 | 762120 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 81 | 1505118 | 1505363 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 82 | 4347539 | 4347784 | + | NZ_CP033744.1 | Citrobacter freundii |
| 83 | 1026723 | 1026968 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 84 | 1701161 | 1701409 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 85 | 1144895 | 1145140 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 86 | 2130345 | 2130590 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 87 | 3497332 | 3497577 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 88 | 271050 | 271295 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 89 | 1298375 | 1298620 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 90 | 1526229 | 1526474 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 91 | 865181 | 865426 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 92 | 1334188 | 1334433 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 93 | 1804108 | 1804353 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 94 | 3186737 | 3186982 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 95 | 3614819 | 3615067 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 96 | 642098 | 642343 | + | NZ_CP035688.1 | Vibrio metoecus |
| 97 | 3391323 | 3391568 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 98 | 2545846 | 2546091 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 99 | 3961561 | 3961806 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 100 | 1411037 | 1411282 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 101 | 1554499 | 1554744 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 102 | 3569112 | 3569360 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 103 | 764542 | 764787 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 104 | 2950050 | 2950307 | + | NZ_CP019959.1 | Vibrio owensii |
| 105 | 2086001 | 2086246 | - | NZ_CP040449.1 | Aeromonas simiae |
| 106 | 665306 | 665551 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 107 | 1564546 | 1564791 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 108 | 1290038 | 1290283 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 109 | 4567285 | 4567530 | - | NZ_CP065640.1 | Serratia rubidaea |
| 110 | 2836333 | 2836578 | + | NZ_CP065640.1 | Serratia rubidaea |
| 111 | 4028449 | 4028694 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 112 | 944532 | 944777 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 113 | 870673 | 870930 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 114 | 2433517 | 2433762 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 115 | 57932 | 58177 | + | NZ_CP038469.1 | Citrobacter tructae |
| 116 | 810587 | 810832 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 117 | 3131348 | 3131593 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 118 | 2106724 | 2106969 | - | NZ_CP067057.1 | Rahnella aceris |
| 119 | 3123096 | 3123341 | + | NZ_CP007230.1 | Yersinia similis |
| 120 | 3437007 | 3437264 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 121 | 3042464 | 3042709 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 122 | 1317268 | 1317513 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 123 | 1376657 | 1376902 | + | NZ_LR134494.1 | Serratia quinivorans |
| 124 | 2814152 | 2814397 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 125 | 4023964 | 4024212 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 126 | 3217837 | 3218082 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 127 | 1512191 | 1512436 | + | NZ_CP046293.1 | Yersinia intermedia |
| 128 | 3161010 | 3161255 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 129 | 1618071 | 1618316 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 130 | 3088205 | 3088450 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 131 | 3462713 | 3462958 | - | NZ_CP023525.1 | Cedecea neteri |
| 132 | 3234209 | 3234454 | - | NZ_LR134201.1 | Cedecea lapagei |
| 133 | 2969463 | 2969708 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 134 | 3680964 | 3681209 | - | NZ_CP071320.1 | Serratia ureilytica |
| 135 | 1378378 | 1378623 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 136 | 1906145 | 1906390 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 137 | 833996 | 834241 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 138 | 3955642 | 3955890 | - | NZ_CP050508.1 | Raoultella terrigena |
| 139 | 1848904 | 1849149 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 140 | 2444570 | 2444815 | - | NZ_AP014635.1 | Vibrio tritonius |
| 141 | 3877995 | 3878240 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 142 | 3552965 | 3553210 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 143 | 1447967 | 1448212 | + | NZ_LT906479.1 | Serratia ficaria |
| 144 | 3249007 | 3249252 | - | NZ_LT906479.1 | Serratia ficaria |
| 145 | 2021415 | 2021660 | + | NZ_CP029736.1 | Providencia rettgeri |
| 146 | 321616 | 321861 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 147 | 575101 | 575346 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 148 | 2285488 | 2285733 | - | NZ_LS483470.1 | Leminorella richardii |
| 149 | 1544316 | 1544561 | + | NZ_LR134531.1 | Pragia fontium |
| 150 | 2242147 | 2242392 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 151 | 3438349 | 3438594 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 152 | 3206110 | 3206355 | - | NZ_CP043727.1 | Yersinia canariae |
| 153 | 3159859 | 3160104 | - | NZ_LS483422.1 | Providencia heimbachae |
| 154 | 3090390 | 3090635 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 155 | 3273108 | 3273353 | - | NZ_CP048796.1 | Providencia vermicola |
| 156 | 3102870 | 3103115 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 157 | 4306259 | 4306504 | + | NZ_CP009787.1 | Yersinia rohdei |
| 158 | 3664173 | 3664421 | - | NZ_CP041247.1 | Raoultella electrica |
| 159 | 2325432 | 2325677 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 160 | 685770 | 686015 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 161 | 1934523 | 1934768 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 162 | 1609801 | 1610046 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 163 | 2677978 | 2678223 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 164 | 901590 | 901835 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 165 | 4626034 | 4626279 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 166 | 1144569 | 1144814 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 167 | 1372205 | 1372450 | + | NC_015968.1 | Enterobacter soli |
| 168 | 668146 | 668391 | + | NZ_CP028271.1 | Mixta intestinalis |
| 169 | 2225120 | 2225365 | - | NZ_CP065534.1 | Lonsdalea populi |
| 170 | 2614249 | 2614494 | - | NZ_CP032487.1 | Yersinia hibernica |
| 171 | 1924024 | 1924266 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 172 | 2308683 | 2308928 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 173 | 3480248 | 3480493 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 174 | 2009505 | 2009750 | - | NZ_AP019657.1 | Vibrio ponticus |
| 175 | 636974 | 637219 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 176 | 3418050 | 3418298 | + | NZ_CP026047.1 | Raoultella planticola |
| 177 | 1921430 | 1921675 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 178 | 595656 | 595901 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 179 | 4226114 | 4226359 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 180 | 2100817 | 2101062 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 181 | 1405589 | 1405834 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 182 | 4156292 | 4156537 | + | NZ_CP049115.1 | Pantoea stewartii |
| 183 | 3813358 | 3813606 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 184 | 188902 | 189147 | - | NZ_CP019706.1 | Pantoea alhagi |
| 185 | 1944393 | 1944638 | + | NZ_CP025799.1 | Dickeya zeae |
| 186 | 3595326 | 3595571 | + | NZ_CP011254.1 | Serratia fonticola |
| 187 | 2148362 | 2148607 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 188 | 1220341 | 1220583 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 189 | 1536692 | 1536940 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 190 | 1113512 | 1113757 | + | NZ_CP046268.1 | Vibrio spartinae |
| 191 | 3390964 | 3391209 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 192 | 3938523 | 3938768 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 193 | 4192526 | 4192774 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 194 | 1367008 | 1367253 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 195 | 1697073 | 1697318 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 196 | 2882154 | 2882399 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 197 | 1898844 | 1899089 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 198 | 982533 | 982778 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 199 | 1436788 | 1437033 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 200 | 2955541 | 2955783 | - | NZ_CP050150.1 | Hafnia alvei |
| 201 | 1418063 | 1418308 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 202 | 1268699 | 1268944 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 203 | 1147376 | 1147621 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 204 | 4113875 | 4114120 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 205 | 1500531 | 1500776 | + | NZ_CP026377.1 | Mixta gaviniae |
| 206 | 1799161 | 1799406 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 207 | 3534626 | 3534871 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 208 | 1405038 | 1405283 | + | NZ_CP061511.1 | Mixta calida |
| 209 | 2852086 | 2852331 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 210 | 114398 | 114649 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 211 | 1205446 | 1205691 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 212 | 2743349 | 2743594 | + | NZ_CP026364.1 | Proteus hauseri |
| 213 | 3144974 | 3145222 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 214 | 4161358 | 4161609 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 215 | 1463188 | 1463433 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 216 | 1033755 | 1034000 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 217 | 2904222 | 2904467 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 218 | 1014838 | 1015083 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 219 | 1937580 | 1937825 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 220 | 344285 | 344527 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 221 | 4193546 | 4193794 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 222 | 861110 | 861355 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 223 | 4084782 | 4085033 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 224 | 3947712 | 3947963 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 225 | 2532046 | 2532288 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 226 | 213652 | 213900 | + | NZ_CP046378.1 | Shewanella algae |
| 227 | 2530244 | 2530489 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 228 | 3028851 | 3029096 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 229 | 1354686 | 1354931 | + | NZ_CP015581.1 | Tatumella citrea |
| 230 | 3568782 | 3569030 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 231 | 5378979 | 5379230 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 232 | 4846396 | 4846647 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 233 | 1693778 | 1694023 | + | NZ_LT615367.1 | Dickeya aquatica |
| 234 | 5225466 | 5225717 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 235 | 328001 | 328252 | + | NC_016901.1 | Shewanella baltica OS678 |
| 236 | 703069 | 703317 | + | NZ_CP028897.1 | Dongshaea marina |
| 237 | 103730 | 103981 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 238 | 1681863 | 1682108 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 239 | 2855348 | 2855593 | - | NZ_CP038853.1 | Pantoea vagans |
| 240 | 6180214 | 6180465 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 241 | 93408 | 93659 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 242 | 2892445 | 2892687 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 243 | 5776611 | 5776862 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 244 | 5001999 | 5002250 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 245 | 3183858 | 3184103 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 246 | 3346058 | 3346306 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 247 | 4450214 | 4450465 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 248 | 4419145 | 4419393 | - | NZ_CP041036.1 | Shewanella polaris |
| 249 | 1017358 | 1017594 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 250 | 1065197 | 1065442 | - | NZ_LS483250.1 | Moritella yayanosii |
| 251 | 141912 | 142163 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 252 | 3335558 | 3335806 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 253 | 4644854 | 4645099 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 254 | 116301 | 116552 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 255 | 4813258 | 4813506 | - | NZ_CP020472.1 | Shewanella japonica |
| 256 | 2269773 | 2270021 | - | NZ_CP036200.1 | Shewanella maritima |
| 257 | 431127 | 431375 | + | NZ_CP009056.1 | Frischella perrara |
| 258 | 350043 | 350291 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 259 | 99538 | 99786 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 260 | 1083799 | 1084026 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 261 | 1242729 | 1242959 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 262 | 2415587 | 2415835 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 263 | 1726564 | 1726812 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134167.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02391.19 | 1.0 | 259 | 2.0 | same-strand | MoaE protein |
| 2 | PF01967.23 | 0.99 | 256 | -3 | same-strand | MoaC family |
| 3 | PF06463.15 | 0.93 | 240 | 1018.0 | same-strand | Molybdenum Cofactor Synthesis C |
| 4 | PF04055.23 | 0.93 | 241 | 1018 | same-strand | Radical SAM superfamily |
| 5 | PF01933.20 | 0.69 | 179 | 2360.5 | opposite-strand | 2-phospho-L-lactate transferase CofD |
| 6 | PF00994.26 | 0.71 | 183 | 485.0 | same-strand | Probable molybdopterin binding domain |
++ More..