Result : P45183
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable molybdenum-pterin-binding protein |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1461986 |
| Right | 1462195 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTAGTGCTAGAAACCAATTAAAGGGTAAAGTTGTTTCAATCGAAAACGGTTCAGTAAATGCAATCGTTCACATCGATATCGGTGGCGGTAACGTACTTTCTTCTACTGTGTCTTTAGCAGCAGTTAAAGAATTAAACTTAGAAGTTGGTAAAGAAGCATACGCAATCATCAAAGCAACTTCTGTAATGGTTGGCGTAGAATAA |
| Sequence | MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIKATSVMVGVE |
| Source of smORF | Swiss-Prot |
| Function | Binds one mole of molybdenum per mole of protein and contains a pterin. {ECO:0000250}. |
| Pubmed ID | 7542800 |
| Domain | CDD:412902 |
| Functional Category | Others |
| Uniprot ID | P45183 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 120
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1510854 | 1511063 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 2 | 1377779 | 1377988 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 1476103 | 1476312 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 4 | 1625490 | 1625699 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 5 | 1904348 | 1904557 | + | NZ_CP031252.1 | Neisseria elongata |
| 6 | 209672 | 209881 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 7 | 1690454 | 1690663 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 8 | 1205790 | 1205999 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 9 | 1625178 | 1625387 | + | NZ_CP028926.1 | Pasteurella multocida |
| 10 | 3545009 | 3545218 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 11 | 1279737 | 1279949 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 12 | 541737 | 541949 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 13 | 3223185 | 3223397 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 14 | 549281 | 549493 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 15 | 2198765 | 2198977 | + | NC_014624.2 | Eubacterium callanderi |
| 16 | 3941301 | 3941513 | + | NZ_CP019962.1 | Eubacterium limosum |
| 17 | 843297 | 843509 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 18 | 2600394 | 2600606 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 19 | 794222 | 794431 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 20 | 3369948 | 3370154 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 21 | 1355317 | 1355526 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 22 | 1407695 | 1407904 | + | NZ_LR134375.1 | Veillonella dispar |
| 23 | 722899 | 723123 | - | NZ_CP030776.1 | Clostridium butyricum |
| 24 | 1465854 | 1466063 | + | NZ_LR778174.1 | Veillonella parvula |
| 25 | 1376962 | 1377168 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 26 | 395700 | 395909 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 27 | 1674087 | 1674296 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 28 | 3351554 | 3351760 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 29 | 3346552 | 3346758 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 30 | 580717 | 580926 | - | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 31 | 1891024 | 1891230 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 32 | 1473612 | 1473824 | + | NZ_LR134406.1 | Arachnia propionica |
| 33 | 2350948 | 2351154 | - | NZ_CP020953.1 | Clostridium drakei |
| 34 | 1707547 | 1707753 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 35 | 1868443 | 1868664 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 36 | 2193371 | 2193577 | + | NZ_CP043998.1 | Clostridium diolis |
| 37 | 1183556 | 1183762 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 38 | 202345 | 202563 | + | NZ_CP030128.1 | Indioceanicola profundi |
| 39 | 1322110 | 1322322 | - | NZ_CP066060.1 | Actinomyces oris |
| 40 | 910816 | 911022 | - | NZ_CP029352.1 | Azospirillum thermophilum |
| 41 | 4320760 | 4320969 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 42 | 688260 | 688469 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 43 | 543683 | 543892 | - | NZ_CP032694.1 | Rhizobium jaguaris |
| 44 | 1894999 | 1895211 | + | NZ_LR134479.1 | Rothia aeria |
| 45 | 2956270 | 2956479 | + | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 46 | 1014224 | 1014448 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 47 | 2360413 | 2360625 | - | NZ_CP066049.1 | Actinomyces naeslundii |
| 48 | 889516 | 889725 | + | NZ_CP072611.1 | Aureimonas populi |
| 49 | 834679 | 834885 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 50 | 3720465 | 3720674 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 51 | 2232905 | 2233117 | - | NZ_CP041036.1 | Shewanella polaris |
| 52 | 487787 | 487993 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 53 | 5153050 | 5153256 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 54 | 1416450 | 1416662 | - | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 55 | 1758916 | 1759128 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 56 | 2595319 | 2595531 | - | NZ_CP014228.1 | Actinomyces radicidentis |
| 57 | 173065 | 173274 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 58 | 3713512 | 3713721 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 59 | 143418 | 143624 | + | NZ_CP036405.1 | Komagataeibacter saccharivorans |
| 60 | 283751 | 283978 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 61 | 502829 | 503041 | - | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 62 | 463630 | 463839 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 63 | 3882610 | 3882819 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 64 | 820385 | 820591 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 65 | 78 | 284 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 66 | 2092450 | 2092656 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 67 | 4805547 | 4805756 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 68 | 206214 | 206426 | + | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 69 | 727471 | 727677 | + | NZ_CP015881.1 | Ensifer adhaerens |
| 70 | 1485742 | 1485945 | - | NZ_CP012946.1 | Blastochloris viridis |
| 71 | 1142581 | 1142793 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 72 | 367301 | 367507 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 73 | 106180 | 106389 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 74 | 4802724 | 4802930 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 75 | 1974383 | 1974595 | - | NC_016901.1 | Shewanella baltica OS678 |
| 76 | 602029 | 602238 | - | NZ_CP018787.1 | Oxalobacter formigenes |
| 77 | 308161 | 308373 | - | NZ_LT615228.1 | Polynucleobacter necessarius |
| 78 | 1254396 | 1254608 | - | NZ_CP008944.1 | Corynebacterium atypicum |
| 79 | 3062434 | 3062643 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 80 | 1157104 | 1157310 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 81 | 1185721 | 1185933 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 82 | 2729198 | 2729410 | + | NZ_CP014681.1 | Kozakia baliensis |
| 83 | 233521 | 233706 | + | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 84 | 3050287 | 3050499 | + | NZ_CP046378.1 | Shewanella algae |
| 85 | 1463701 | 1463910 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 86 | 794956 | 795159 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 87 | 2072553 | 2072762 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 88 | 2578812 | 2579015 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 89 | 716280 | 716483 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 90 | 342545 | 342751 | - | NZ_CP026606.1 | Methanococcus maripaludis |
| 91 | 254651 | 254863 | + | NZ_CP040882.1 | Sutterella faecalis |
| 92 | 2418534 | 2418737 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 93 | 735969 | 736139 | - | NZ_CP012543.1 | Campylobacter rectus |
| 94 | 1527289 | 1527498 | - | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
| 95 | 4025021 | 4025224 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 96 | 8081867 | 8082082 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 97 | 769015 | 769221 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 98 | 4130657 | 4130863 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 99 | 1152611 | 1152817 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 100 | 1808506 | 1808715 | - | NC_018227.2 | Methanoculleus bourgensis MS2 |
| 101 | 1065550 | 1065759 | + | NC_014507.1 | Methanolacinia petrolearia DSM 11571 |
| 102 | 3982084 | 3982293 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 103 | 2220163 | 2220372 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 104 | 1847387 | 1847596 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 105 | 2560564 | 2560773 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 106 | 1929707 | 1929916 | + | NZ_CP036200.1 | Shewanella maritima |
| 107 | 650030 | 650239 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 108 | 678748 | 678957 | - | NZ_CP020472.1 | Shewanella japonica |
| 109 | 1371404 | 1371613 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 110 | 3152887 | 3153090 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 111 | 1593139 | 1593348 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 112 | 2351016 | 2351225 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 113 | 3869466 | 3869675 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 114 | 3731322 | 3731531 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 115 | 3909869 | 3910072 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 116 | 3315090 | 3315296 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 117 | 7044991 | 7045200 | + | NZ_CP040017.1 | Massilia umbonata |
| 118 | 3806712 | 3806921 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 119 | 796693 | 796902 | - | NZ_CP045073.1 | Paracoccus kondratievae |
| 120 | 4426884 | 4427093 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 121 | 4520005 | 4520214 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 122 | 517839 | 518048 | + | NZ_CP032683.1 | Methanosarcina flavescens |
| 123 | 1596016 | 1596222 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 124 | 7582840 | 7583049 | + | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 125 | 664889 | 665095 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
++ More..