Result : P45035
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Heme exporter protein D (Cytochrome c-type biogenesis protein CcmD) |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1155891 |
| Right | 1156094 |
| Strand | + |
| Nucleotide Sequence | ATGTTTTTCCAAACTTGGAGTGATTTTTTTAATATGGGTGGCTACGGTTTTTACGTATGGTTATCCTATGCAGTAAGTTTAGTGGCAGTTATTGCCTTAATTGTTCAAAGCGTCAAGCAACGCAAGACAGTATTACAAAATGTCTTGCGTGAGAAACAACGCGAAGAACGTTTACAACAAGCAAATAAGGGGAATACACTATGA |
| Sequence | MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREKQREERLQQANKGNTL |
| Source of smORF | Swiss-Prot |
| Function | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. {ECO:0000305}. |
| Pubmed ID | 7542800 |
| Domain | CDD:416290 |
| Functional Category | Others |
| Uniprot ID | P45035 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1770412 | 1770615 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 834481 | 834684 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 3 | 1145178 | 1145381 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 4 | 821297 | 821500 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 1136121 | 1136324 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 1448114 | 1448317 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 7 | 1406045 | 1406248 | + | NZ_CP028926.1 | Pasteurella multocida |
| 8 | 982015 | 982221 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 9 | 857743 | 857949 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 10 | 475575 | 475781 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 11 | 565465 | 565668 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 12 | 181702 | 181905 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 13 | 1149374 | 1149568 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 14 | 667090 | 667293 | + | NZ_LR134167.1 | Avibacterium volantium |
| 15 | 323577 | 323744 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 16 | 2435677 | 2435874 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 17 | 194487 | 194687 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 18 | 424856 | 425050 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 19 | 1601241 | 1601438 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 20 | 811986 | 812180 | + | NZ_CP061280.1 | Mannheimia bovis |
| 21 | 2416516 | 2416707 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 22 | 2353397 | 2353588 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 23 | 2093222 | 2093416 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 24 | 4665627 | 4665827 | + | NZ_CP046378.1 | Shewanella algae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16327.7 | 0.83 | 20 | 531.5 | same-strand | Cytochrome c-type biogenesis protein CcmF C-terminal |
| 2 | PF01578.22 | 0.96 | 23 | 84 | same-strand | Cytochrome C assembly protein |
| 3 | PF03100.17 | 0.96 | 23 | -3 | same-strand | CcmE |
| 4 | PF03379.15 | 1.0 | 24 | 797.0 | same-strand | CcmB protein |
| 5 | PF01061.26 | 0.79 | 19 | 798 | same-strand | ABC-2 type transporter |
| 6 | PF00005.29 | 1.0 | 24 | 1492 | same-strand | ABC transporter |
++ More..