ProsmORF-pred
Result : P45026
Protein Information
Information Type Description
Protein name Uncharacterized protein HI_1082
NCBI Accession ID L42023.1
Organism Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Left 1149047
Right 1149304
Strand -
Nucleotide Sequence ATGGAACTTCAAAAAATTGAACAAATTTTAAAAGACACACTAAATATTGCAGAAGTCTATGCACAAGGTGAAAATGCACATTTTGGTGTGATTGTTGTGAGTGATGAAATCGCTGCACTATCTCGTGTAAAACAACAACAAACGATTTATGCCCCTTTAATGCCTTATTTTAGTACTGGTGAAATTCACGCTCTAACCATCAAAACTTATACCGTAGAAAAATGGAAACGCGATCGTGCATTAAACCAGTTTAATTAA
Sequence MELQKIEQILKDTLNIAEVYAQGENAHFGVIVVSDEIAALSRVKQQQTIYAPLMPYFSTGEIHALTIKTYTVEKWKRDRALNQFN
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00386. Profile Description: BolA-like protein. transcriptional regulator BolA; Provisional
Pubmed ID 7542800 10675023
Domain CDD:412350
Functional Category Others
Uniprot ID P45026
ORF Length (Amino Acid) 85
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 94
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1777181 1777438 + NZ_CP009610.1 Haemophilus influenzae
2 1138281 1138538 - NZ_LS483429.1 Haemophilus aegyptius
3 32125 32382 - NZ_LS483458.1 Haemophilus haemolyticus
4 800954 801211 - NZ_CP040863.1 Rodentibacter heylii
5 1111071 1111331 + NZ_LT906463.1 Haemophilus pittmaniae
6 1938852 1939109 - NZ_LR134167.1 Avibacterium volantium
7 837518 837769 + NZ_CP018804.1 Histophilus somni
8 1512370 1512627 - NZ_CP016605.1 Bisgaardia hudsonensis
9 1312671 1312928 - NZ_CP015031.1 Basfia succiniciproducens
10 1700168 1700425 - NC_006300.1 [Mannheimia] succiniciproducens MBEL55E
11 1586541 1586798 + NZ_CP028926.1 Pasteurella multocida
12 1244486 1244743 - NZ_LT906448.1 Pasteurella dagmatis
13 1365158 1365412 + NZ_LR134510.1 Actinobacillus delphinicola
14 2253499 2253756 + NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
15 916378 916635 - NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
16 902562 902822 + NZ_CP046531.1 Mannheimia ovis
17 1003440 1003700 + NZ_CP055305.1 Mannheimia pernigra
18 916949 917209 + NZ_CP061280.1 Mannheimia bovis
19 387590 387847 + NZ_CP016604.1 Otariodibacter oris
20 566667 566927 + NC_021883.1 Mannheimia haemolytica USMARC_2286
21 753501 753758 - NC_011852.1 Glaesserella parasuis SH0165
22 1512480 1512740 - NZ_CP030753.1 Actinobacillus pleuropneumoniae
23 518141 518401 + NZ_CP006944.1 Mannheimia varigena USDA-ARS-USMARC-1312
24 49861 50121 + NZ_CP007715.1 Actinobacillus equuli subsp. equuli
25 62922 63182 + NZ_CP009159.1 Actinobacillus suis ATCC 33415
26 1529703 1529960 - NZ_CP016180.1 Pasteurella skyensis
27 86467 86727 - NZ_CP029206.1 Actinobacillus porcitonsillarum
28 629182 629442 + NZ_CP015425.1 [Haemophilus] ducreyi
29 2029059 2029316 - NZ_CP015029.1 Frederiksenia canicola
30 1421227 1421481 + NZ_CP023009.1 Lonsdalea britannica
31 3522149 3522403 - NZ_CP065534.1 Lonsdalea populi
32 4218053 4218307 - NZ_CP006569.1 Sodalis praecaptivus
33 4272685 4272939 - NC_012962.1 Photorhabdus asymbiotica
34 4721578 4721832 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
35 523899 524153 + NZ_CP047349.1 Proteus terrae subsp. cibarius
36 3043880 3044134 + NZ_CP011104.1 Photorhabdus thracensis
37 721055 721312 + NZ_CP046670.1 Alteromonas mediterranea
38 3966121 3966372 - NZ_CP022358.1 Shewanella bicestrii
39 2114147 2114401 + NZ_CP026364.1 Proteus hauseri
40 3994738 3994992 + NC_010554.1 Proteus mirabilis HI4320
41 1567277 1567531 + NZ_CP007044.2 Chania multitudinisentens RB-25
42 3255712 3255966 + NZ_CP014136.1 Gibbsiella quercinecans
43 4439035 4439289 - NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
44 573287 573541 + NZ_CP026377.1 Mixta gaviniae
45 4614344 4614598 - NZ_LT906479.1 Serratia ficaria
46 498522 498776 + NZ_CP061511.1 Mixta calida
47 943888 944142 - NZ_CP065640.1 Serratia rubidaea
48 4818927 4819181 - NC_015567.1 Serratia plymuthica AS9
49 872418 872675 + NC_016901.1 Shewanella baltica OS678
50 4761480 4761734 - NZ_LR134494.1 Serratia quinivorans
51 3214511 3214765 - NC_012691.1 Tolumonas auensis DSM 9187
52 3586382 3586636 - NZ_CP023567.1 Erwinia pyrifoliae
53 3869408 3869662 - NZ_CP016948.1 Serratia surfactantfaciens
54 4652100 4652354 - NZ_CP038662.1 Serratia nematodiphila
55 515170 515424 + NZ_LN907827.1 Erwinia gerundensis
56 1092874 1093128 - NZ_CP019706.1 Pantoea alhagi
57 726558 726815 + NZ_CP031769.1 Salinimonas sediminis
58 384881 385135 + NC_010694.1 Erwinia tasmaniensis Et1/99
59 385051 385305 + NC_013961.1 Erwinia amylovora CFBP1430
60 4334379 4334633 + NZ_CP028271.1 Mixta intestinalis
61 349194 349448 + NZ_CP009125.1 Pectobacterium atrosepticum
62 3101886 3102140 - NZ_LS483470.1 Leminorella richardii
63 3623479 3623733 - NZ_CP034752.1 Jinshanibacter zhutongyuii
64 1255751 1256005 - NZ_CP047495.1 Pectobacterium brasiliense
65 4493514 4493768 - NZ_CP051652.1 Pectobacterium carotovorum
66 4585222 4585476 - NZ_CP065044.1 Pectobacterium aroidearum
67 351770 352024 + NZ_CP034938.1 Pectobacterium odoriferum
68 537678 537932 + NZ_CP071320.1 Serratia ureilytica
69 4883643 4883897 + NC_013716.1 Citrobacter rodentium ICC168
70 3203845 3204099 - NZ_CP029185.2 Limnobaculum parvum
71 4709464 4709718 - NZ_CP048784.1 Serratia liquefaciens
72 398217 398471 + NZ_LT615367.1 Dickeya aquatica
73 331936 332190 + NZ_CP023525.1 Cedecea neteri
74 335170 335424 + NZ_LR134201.1 Cedecea lapagei
75 4233099 4233353 - NC_012880.1 Musicola paradisiaca Ech703
76 530698 530952 + NZ_CP050508.1 Raoultella terrigena
77 335832 336086 - NZ_CP020388.1 Pluralibacter gergoviae
78 3654977 3655231 - NZ_CP048796.1 Providencia vermicola
79 3798114 3798368 + NZ_CP016176.1 Xenorhabdus hominickii
80 2509630 2509884 + NZ_CP015137.1 Dickeya solani IPO 2222
81 341000 341254 + NZ_CP031560.1 Dickeya dianthicola
82 350484 350738 + NC_014500.1 Dickeya dadantii 3937
83 4051158 4051412 - NZ_CP042220.2 Dickeya poaceiphila
84 4493835 4494089 - NC_014306.1 Erwinia billingiae Eb661
85 498722 498976 + NZ_AP023184.1 Buttiauxella agrestis
86 1132910 1133164 - NZ_CP023706.1 Edwardsiella tarda
87 3712255 3712509 - NZ_FO704550.1 Xenorhabdus doucetiae
88 1757975 1758229 - NZ_CP011078.1 Yersinia ruckeri
89 3159189 3159443 - NZ_CP016043.1 Edwardsiella hoshinae
90 2637725 2637979 - NZ_AP019651.1 Vibrio taketomensis
91 20807 21061 + NZ_AP019657.1 Vibrio ponticus
92 2284584 2284838 + NZ_CP006664.1 Edwardsiella anguillarum ET080813
93 398515 398769 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
94 3821837 3822091 + NZ_CP060401.1 Xenorhabdus nematophila
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LS483458.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00005.29 0.99 93 2427.0 same-strand ABC transporter
2 PF02405.18 1.0 94 1638.0 same-strand Permease MlaE
3 PF02470.22 1.0 94 1083.5 same-strand MlaD protein
4 PF05494.14 1.0 94 427.5 same-strand MlaC protein
5 PF00275.22 1.0 94 55.5 same-strand EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)
6 PF13466.8 0.96 90 133.0 same-strand STAS domain
++ More..