Result : P44686
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0381 protein HI_0400 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 421650 |
| Right | 421937 |
| Strand | - |
| Nucleotide Sequence | ATGACCGTAAAATGCAAAGCAGAAGAATCCTTAACTTGTAGCTGTGTTGATGTAGGCACTATTATTGATGGCTCTGACTGTAGCGTAGAAGTACATCAATTTTATAGCACTGAAGCTGATGCCAATGCAGTGCTTGAACGATTAACAAAGAAAGCGCGCAATACAGAAAGCGATCCTTGCGAAATTAAAAGCGAAATCGTGGCAGTTGAAAACGGCGTTCAATTAAATGCTTCTTTCACTTTTAGTTGCCAAGCAGAAGCGATGATTTTTGAACTGGCGAATCGTTAA |
| Sequence | MTVKCKAEESLTCSCVDVGTIIDGSDCSVEVHQFYSTEADANAVLERLTKKARNTESDPCEIKSEIVAVENGVQLNASFTFSCQAEAMIFELANR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11449. Profile Description: Protein of unknown function (DUF406). These small proteins are approximately 100 amino acids in length and appear to be found only in gamma proteobacteria. The function of this protein family is unknown. [Hypothetical proteins, Conserved] |
| Pubmed ID | 7542800 |
| Domain | CDD:416274 |
| Functional Category | Others |
| Uniprot ID | P44686 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 621853 | 622140 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 697773 | 698060 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 68105 | 68392 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 950496 | 950783 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 1381954 | 1382241 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 914760 | 915014 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 7 | 361362 | 361598 | + | NZ_CP028926.1 | Pasteurella multocida |
| 8 | 855692 | 855928 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 9 | 159821 | 160057 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 10 | 1168433 | 1168675 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 11 | 658438 | 658680 | + | NZ_CP016604.1 | Otariodibacter oris |
| 12 | 1419628 | 1419870 | + | NZ_CP071320.1 | Serratia ureilytica |
| 13 | 3679404 | 3679646 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 14 | 3095107 | 3095403 | - | NZ_CP050150.1 | Hafnia alvei |
| 15 | 99265 | 99501 | + | NZ_CP067057.1 | Rahnella aceris |
| 16 | 4977681 | 4977923 | - | NZ_CP065640.1 | Serratia rubidaea |
| 17 | 3710757 | 3710999 | - | NZ_LT906479.1 | Serratia ficaria |
| 18 | 5893450 | 5893746 | - | NZ_CP011254.1 | Serratia fonticola |
| 19 | 195183 | 195482 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 20 | 2995056 | 2995298 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 21 | 1460054 | 1460296 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 22 | 2643161 | 2643457 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 23 | 3687471 | 3687767 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 24 | 3809216 | 3809500 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 25 | 2787445 | 2787681 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 26 | 3519949 | 3520245 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 27 | 663488 | 663784 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 28 | 3210236 | 3210532 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 29 | 2544319 | 2544615 | - | NZ_CP065534.1 | Lonsdalea populi |
| 30 | 302134 | 302421 | + | NZ_CP046531.1 | Mannheimia ovis |
| 31 | 1200775 | 1201011 | + | NZ_CP038853.1 | Pantoea vagans |
| 32 | 331369 | 331656 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 33 | 3047339 | 3047581 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 34 | 2813249 | 2813545 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 35 | 48879 | 49115 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 36 | 3363452 | 3363748 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 37 | 2076946 | 2077188 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 38 | 1133444 | 1133740 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 39 | 2551022 | 2551318 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 40 | 3757638 | 3757934 | - | NZ_LR134494.1 | Serratia quinivorans |
| 41 | 1940352 | 1940648 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 42 | 1544412 | 1544696 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 43 | 1950498 | 1950779 | - | NZ_CP018804.1 | Histophilus somni |
| 44 | 180275 | 180511 | - | NZ_CP026364.1 | Proteus hauseri |
| 45 | 2269685 | 2269981 | - | NZ_CP007445.1 | Gilliamella apicola |
| 46 | 614296 | 614538 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 47 | 218020 | 218307 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 48 | 574194 | 574481 | - | NZ_CP061280.1 | Mannheimia bovis |
| 49 | 1428592 | 1428888 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 50 | 2112063 | 2112326 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 51 | 870490 | 870726 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 52 | 2004704 | 2004967 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 53 | 1881991 | 1882254 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 54 | 1524773 | 1525069 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 55 | 3323796 | 3324092 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 56 | 1636544 | 1636840 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 57 | 3194167 | 3194463 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 58 | 825492 | 825734 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 59 | 238243 | 238539 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 60 | 2141525 | 2141821 | - | NZ_CP017482.1 | Pectobacterium polaris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03349.18 | 0.8 | 48 | 389.0 | opposite-strand | Outer membrane protein transport protein (OMPP1/FadL/TodX) |
++ More..