Result : P44651
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chaperone NapD (NapA signal peptide-binding chaperone NapD) |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 370110 |
| Right | 370391 |
| Strand | + |
| Nucleotide Sequence | ATGAATAATACAAATTTAATATTAGAAAATGCGAGAGATTGGCACGTNGTTGGATTGATCGTGCAAGGTAATCCAAAAAAATTATCAGCAATTCAAACCGCACTTTTAGCGATTGAGCATACTGAAATTCCGACTCTTGATGAAAAACTTGGAAAATTTGTGGTGGTAATGCAATCGAACGATCAGCATCTCTTGCTTGAAAAAATGGAAAGTGTGAAAGATATCGACGGTGTGATTAATGTATCGTTGGTGTATCACGAGCAAGATGAACAAAATAAATAG |
| Sequence | MNNTNLILENARDWHVVGLIVQGNPKKLSAIQTALLAIEHTEIPTLDEKLGKFVVVMQSNDQHLLLEKMESVKDIDGVINVSLVYHEQDEQNK |
| Source of smORF | Swiss-Prot |
| Function | Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export. {ECO:0000255|HAMAP-Rule:MF_02200}. |
| Pubmed ID | 7542800 |
| Domain | CDD:412773 |
| Functional Category | Others |
| Uniprot ID | P44651 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 722264 | 722545 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 800727 | 801008 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 138019 | 138300 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1948469 | 1948753 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 1333004 | 1333288 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 6 | 384059 | 384343 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 7 | 876585 | 876842 | - | NZ_CP028926.1 | Pasteurella multocida |
| 8 | 1827221 | 1827478 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 9 | 1992172 | 1992399 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 10 | 227300 | 227563 | - | NZ_LR134167.1 | Avibacterium volantium |
| 11 | 1944892 | 1945119 | - | NZ_CP018804.1 | Histophilus somni |
| 12 | 22784 | 23014 | - | NZ_CP011254.1 | Serratia fonticola |
| 13 | 3876776 | 3877006 | - | NZ_LR134494.1 | Serratia quinivorans |
| 14 | 3924689 | 3924922 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 15 | 2564904 | 2565137 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 16 | 3812378 | 3812608 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 17 | 1333318 | 1333551 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 18 | 1538815 | 1539048 | - | NZ_CP009787.1 | Yersinia rohdei |
| 19 | 4164600 | 4164833 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 20 | 1328175 | 1328411 | + | NZ_CP043727.1 | Yersinia canariae |
| 21 | 1156803 | 1157033 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 22 | 88780 | 89010 | - | NZ_CP065640.1 | Serratia rubidaea |
| 23 | 1400154 | 1400387 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 24 | 4865701 | 4865934 | - | NZ_CP007230.1 | Yersinia similis |
| 25 | 3078738 | 3078971 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134327.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03264.16 | 1.0 | 25 | 4612 | same-strand | NapC/NirT cytochrome c family, N-terminal region |
| 2 | PF03892.16 | 0.88 | 22 | 4152.5 | same-strand | Nitrate reductase cytochrome c-type subunit (NapB) |
| 3 | PF12801.9 | 0.6 | 15 | 3344 | same-strand | 4Fe-4S binding domain |
| 4 | PF13237.8 | 0.84 | 21 | 2592 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13187.8 | 0.96 | 24 | 26 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF14697.8 | 0.92 | 23 | 26.0 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF12797.9 | 0.6 | 15 | 24.5 | same-strand | 4Fe-4S binding domain |
| 8 | PF12838.9 | 0.96 | 24 | 26.5 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF00384.24 | 1.0 | 25 | -3 | same-strand | Molybdopterin oxidoreductase |
| 10 | PF01568.23 | 1.0 | 25 | -3 | same-strand | Molydopterin dinucleotide binding domain |
| 11 | PF04879.18 | 1.0 | 25 | -3 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 12 | PF10518.11 | 1.0 | 25 | -3 | same-strand | TAT (twin-arginine translocation) pathway signal sequence |
| 13 | PF04545.18 | 0.72 | 18 | 2699.0 | opposite-strand | Sigma-70, region 4 |
| 14 | PF13675.8 | 0.6 | 15 | 814 | opposite-strand | Type IV pili methyl-accepting chemotaxis transducer N-term |
| 15 | PF07730.15 | 0.6 | 15 | 814 | opposite-strand | Histidine kinase |
| 16 | PF00672.27 | 0.6 | 15 | 814 | opposite-strand | HAMP domain |
| 17 | PF02518.28 | 0.6 | 15 | 844 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
++ More..