Result : A0AKG0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein lwe2074 |
| NCBI Accession ID | AM263198.1 |
| Organism | Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8) |
| Left | 2109247 |
| Right | 2109528 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAATGATAGACAAGCTATCGTCGTTTGGATGAATCATCTCAAACAAGTTAGATCTTTGAAGCGATTTGGAAATGTTCATTATGTATCCCGTAAATTAAAATATGCGGTGTTATATTGTGATATGGCCGAAGTAGAAGATATCTCTGAAAAAGTTTCTCGTTTTCATTATGTGAAACGTGTGGAAATGTCTTTCCGTCCGTTCCTAAAAACAGAATACGAATCCAAAAAAGAAATGATGTATGAACATAAAAACGAAGATGTACAAATCAGTATTTAA |
| Sequence | MENDRQAIVVWMNHLKQVRSLKRFGNVHYVSRKLKYAVLYCDMAEVEDISEKVSRFHYVKRVEMSFRPFLKTEYESKKEMMYEHKNEDVQISI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 16936040 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | A0AKG0 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2108934 | 2109215 | - | NZ_LT906444.1 | Listeria welshimeri |
| 2 | 2136893 | 2137174 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 3 | 2095040 | 2095321 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 4 | 2197641 | 2197922 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 5 | 818091 | 818372 | + | NZ_LR134483.1 | Listeria grayi |
| 6 | 1317708 | 1317989 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 7 | 1458853 | 1459128 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 8 | 515577 | 515864 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 9 | 2669832 | 2670107 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 10 | 1261509 | 1261784 | + | NZ_CP012024.1 | Bacillus smithii |
| 11 | 1651471 | 1651746 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 12 | 231985 | 232257 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 65122 | 65394 | - | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2862704 | 2862973 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 15 | 2762085 | 2762360 | - | NZ_LS483476.1 | Lederbergia lentus |
| 16 | 1467234 | 1467506 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 17 | 1694013 | 1694285 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 18 | 2435970 | 2436242 | - | NZ_CP011937.1 | Bacillus velezensis |
| 19 | 1524900 | 1525172 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 20 | 2880507 | 2880788 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 253301 | 253576 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 22 | 2482380 | 2482652 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 23 | 1116805 | 1117074 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 24 | 212591 | 212860 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 25 | 561578 | 561847 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 26 | 2131221 | 2131463 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 27 | 1745690 | 1745962 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 28 | 1702324 | 1702608 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 1952453 | 1952728 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 30 | 3495320 | 3495592 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 31 | 5066617 | 5066892 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 32 | 2250229 | 2250498 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 33 | 2442997 | 2443269 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 34 | 2829369 | 2829644 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 35 | 949072 | 949329 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 36 | 1354457 | 1354732 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 37 | 3378165 | 3378437 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 38 | 4126015 | 4126290 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 39 | 1054064 | 1054339 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 40 | 2467412 | 2467654 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 41 | 2280755 | 2280988 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 42 | 2176403 | 2176636 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 43 | 2938063 | 2938296 | + | NZ_CP013661.2 | Planococcus kocurii |
| 44 | 2325400 | 2325633 | - | NZ_CP019401.1 | Planococcus faecalis |
| 45 | 2190599 | 2190841 | - | NZ_CP016540.2 | Planococcus versutus |
| 46 | 2051085 | 2051327 | - | NZ_CP016538.2 | Planococcus maritimus |
| 47 | 2028813 | 2029055 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 48 | 2074335 | 2074577 | - | NZ_CP059540.1 | Planococcus maritimus |
| 49 | 1847312 | 1847554 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 50 | 2630417 | 2630659 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 51 | 2945701 | 2945973 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 52 | 1878916 | 1879158 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 53 | 2052354 | 2052629 | + | NZ_CP053989.1 | Niallia circulans |
| 54 | 1560098 | 1560373 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906444.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01467.28 | 1.0 | 53 | 1386.5 | same-strand | Cytidylyltransferase-like |
| 2 | PF03602.17 | 1.0 | 53 | 808.0 | same-strand | Conserved hypothetical protein 95 |
| 3 | PF06133.13 | 1.0 | 53 | 130.5 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
| 4 | PF14504.8 | 0.72 | 38 | 1744 | same-strand | CAP-associated N-terminal |
| 5 | PF00188.28 | 0.74 | 39 | 1783.5 | same-strand | Cysteine-rich secretory protein family |
++ More..