Result : P44593
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative sulfur carrier protein HI_0242 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 270799 |
| Right | 271020 |
| Strand | - |
| Nucleotide Sequence | ATGAAATATCAGCTCAATTTAACCGCACTTCGATGCCCCATTCCTCTTTTAAGTGCTAAAAAAGCCTTAAAAAATTTGGATAAAAATGATGAGCTAATGTTGATCTTAAACCTTGAAAGTGCGGTGGAAAATTTTTCTATTTTTGCCGAAGAAAATTCTGTTGCTTTGGTCGAGCAATATTACGCTTCGGAAAAAGAATTTATCGTTATCTTGAAAAAATAA |
| Sequence | MKYQLNLTALRCPIPLLSAKKALKNLDKNDELMLILNLESAVENFSIFAEENSVALVEQYYASEKEFIVILKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 7542800 |
| Domain | CDD:412376 |
| Functional Category | Others |
| Uniprot ID | P44593 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 758910 | 759131 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 2 | 908990 | 909211 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 821585 | 821806 | + | NZ_CP009610.1 | Haemophilus influenzae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483458.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02547.17 | 1.0 | 3 | 2073 | same-strand | Queuosine biosynthesis protein |
| 2 | PF01702.20 | 1.0 | 3 | 580 | same-strand | Queuine tRNA-ribosyltransferase |
| 3 | PF01814.25 | 1.0 | 3 | -3 | same-strand | Hemerythrin HHE cation binding domain |
| 4 | PF02699.17 | 1.0 | 3 | 108 | same-strand | Preprotein translocase subunit |
| 5 | PF13721.8 | 1.0 | 3 | 471 | same-strand | SecD export protein N-terminal TM region |
| 6 | PF02355.18 | 1.0 | 3 | 1402.5 | same-strand | Protein export membrane protein |
| 7 | PF07549.16 | 1.0 | 3 | 1402.5 | same-strand | SecD/SecF GG Motif |
| 8 | PF01594.18 | 1.0 | 3 | 3420 | opposite-strand | AI-2E family transporter |
| 9 | PF03960.17 | 1.0 | 3 | 4548 | same-strand | ArsC family |
++ More..