Result : P44281
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1650 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1716547 |
| Right | 1716657 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAACGAACGTAATATTCAAAATTATCACTCGACTTACAACAACATTCGGGATTGGCTTGGTTATCAAAAAGCTGGCGAGGAAAAAGCAAAGTCGACCATCAATTAG |
| Sequence | MPNERNIQNYHSTYNNIRDWLGYQKAGEEKAKSTIN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44281 |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1715238 | 1715348 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 1215399 | 1215509 | - | NZ_CP009610.1 | Haemophilus influenzae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483429.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00575.25 | 1.0 | 2 | 5214.5 | opposite-strand | S1 RNA binding domain |
| 2 | PF02224.20 | 1.0 | 2 | 4412.0 | opposite-strand | Cytidylate kinase |
| 3 | PF13238.8 | 1.0 | 2 | 4412.0 | opposite-strand | AAA domain |
| 4 | PF01680.19 | 1.0 | 2 | 3080.5 | same-strand | SOR/SNZ family |
| 5 | PF01174.21 | 1.0 | 2 | 2501.5 | same-strand | SNO glutamine amidotransferase family |
| 6 | PF00117.30 | 1.0 | 2 | 2501.5 | same-strand | Glutamine amidotransferase class-I |
| 7 | PF09330.13 | 1.0 | 2 | 259.0 | opposite-strand | D-lactate dehydrogenase, membrane binding |
| 8 | PF01565.25 | 1.0 | 2 | 259.0 | opposite-strand | FAD binding domain |
| 9 | PF00877.21 | 1.0 | 2 | 537.0 | opposite-strand | NlpC/P60 family |
| 10 | PF19289.1 | 1.0 | 2 | 1202.5 | opposite-strand | PmbA/TldA metallopeptidase C-terminal domain |
| 11 | PF19290.1 | 1.0 | 2 | 1202.5 | opposite-strand | PmbA/TldA metallopeptidase central domain |
| 12 | PF01523.18 | 1.0 | 2 | 1202.5 | opposite-strand | PmbA/TldA metallopeptidase domain 1 |
| 13 | PF00590.22 | 1.0 | 2 | 2752.5 | opposite-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 14 | PF04348.15 | 1.0 | 2 | 3675.5 | same-strand | LppC putative lipoprotein |
| 15 | PF02021.19 | 1.0 | 2 | 5402.5 | same-strand | Uncharacterised protein family UPF0102 |
++ More..