Result : P44260
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1571 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1638049 |
| Right | 1638288 |
| Strand | - |
| Nucleotide Sequence | TTGTCATTGCGCCACCTTGCGCAAATTATCACTCAACAAATCATTTTGCCGTATTTGCAAATTAATGTTGATCCGAATATTGCGCCACATCGTATCCCTTATTTTGAGTTTGACACAAAAGAATATGAAGACTTATCGGTATTTGCAGATGCCATCCCTAAACTTACGGGCATTGGCGTGCAGATTTCGGAAAGTTGGGTGTGGGATAAATTAGGGATTCCTGAACCGCAGGAAGGTTAG |
| Sequence | MSLRHLAQIITQQIILPYLQINVDPNIAPHRIPYFEFDTKEYEDLSVFADAIPKLTGIGVQISESWVWDKLGIPEPQEG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44260 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1557132 | 1557371 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 767434 | 767673 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 1396771 | 1397010 | + | NZ_LS483429.1 | Haemophilus aegyptius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18812.3 | 1.0 | 2 | 12 | same-strand | phage-Barnase-EndoU-ColicinE5/D-RelE like nuclease3 |
++ More..