Protein Information |
Information Type | Description |
---|---|
Protein name | Mu-like prophage FluMu protein gp38 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1581221 |
Right | 1581412 |
Strand | + |
Nucleotide Sequence | ATGCCAACATTTAAAATTAAGCCTAAAACAGGATTGCTGATTCGAGACCCAGAGACCTTTGAGTTGTTAAGCGAAAGCGGTGAAGATAAGCCCAAAATCAGCTACTGGCTCAATCATCTTAAAAATGGCGATGTGGAGCTGGTCACAGAAACCACCACAAAAGCCAAAAATAGCAACAAGGAGCAAGCCTAA |
Sequence | MPTFKIKPKTGLLIRDPETFELLSESGEDKPKISYWLNHLKNGDVELVTETTTKAKNSNKEQA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10948. Profile Description: Protein of unknown function (DUF2635). This is a family of phage proteins with unknown function. |
Pubmed ID | 7542800 |
Domain | CDD:378516 |
Functional Category | Others |
Uniprot ID | P44232 |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 523901 | 524083 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
2 | 152568 | 152768 | + | NZ_CP018311.1 | Vibrio rotiferianus |
3 | 529787 | 529969 | - | NZ_CP014034.2 | Vibrio fluvialis |
4 | 2363653 | 2363826 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04984.16 | 1.0 | 4 | -1.5 | same-strand | Phage tail sheath protein subtilisin-like domain |
2 | PF17482.4 | 1.0 | 4 | -1.5 | same-strand | Phage tail sheath C-terminal domain |
3 | PF10618.11 | 1.0 | 4 | 1309.5 | same-strand | Phage tail tube protein |
4 | PF10109.11 | 0.75 | 3 | 2189 | same-strand | Phage tail assembly chaperone proteins, E, or 41 or 14 |