Result : P44191
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1420 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1510258 |
| Right | 1510551 |
| Strand | + |
| Nucleotide Sequence | ATGACTGAACAATTAAAAGACTTTGATGTGGCAGAACACCTCACTTCTGAAGAAGAAATTCAACTTTACCTTAATGAAATTCTACAAGAAGATAATATTGAGCTTATTTTATCCGCCCTTGGCGACATAGCCCGTGCGCGTAACATGAGCCAAATCGCACGTGATGCAGGAATAAGCCGAGAAGGTCTTTATAAAGCCTTATCTGGCACGGGCAATCCTACTTTTGCTACTGTAATGAAAGTAATGAAAGCCTTAAATTTACAATTCCAAGTGCAACAATCTCGATTCGCCTAA |
| Sequence | MTEQLKDFDVAEHLTSEEEIQLYLNEILQEDNIELILSALGDIARARNMSQIARDAGISREGLYKALSGTGNPTFATVMKVMKALNLQFQVQQSRFA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 7542800 |
| Domain | CDD:419869 |
| Functional Category | Others |
| Uniprot ID | P44191 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 908584 | 908877 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 2 | 644456 | 644722 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 3 | 2707235 | 2707513 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 4 | 31468 | 31713 | - | NC_010697.1 | Erwinia tasmaniensis Et1/99 |
| 5 | 1323341 | 1323634 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 6 | 2120064 | 2120330 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 7 | 1691362 | 1691661 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 8 | 3022167 | 3022472 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 9 | 2972403 | 2972699 | + | NZ_CP035503.1 | Rhodoferax sediminis |
| 10 | 3205651 | 3205968 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 11 | 3873903 | 3874187 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 12 | 1588579 | 1588872 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 13 | 4121046 | 4121288 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 14 | 1733897 | 1734196 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 15 | 152346 | 152657 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 16 | 3484052 | 3484354 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 17 | 2797487 | 2797801 | - | NZ_CP059082.1 | Halomonas titanicae |
| 18 | 1011522 | 1011815 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 19 | 5286661 | 5286954 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 20 | 423951 | 424253 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 21 | 458805 | 459107 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 22 | 31259 | 31543 | - | NC_010555.1 | Proteus mirabilis HI4320 |
| 23 | 4335791 | 4336093 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 24 | 4434424 | 4434708 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 25 | 113267 | 113551 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 26 | 4106572 | 4106820 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 27 | 1272448 | 1272732 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 28 | 496210 | 496497 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 29 | 512199 | 512486 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 30 | 897697 | 897960 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 31 | 217455 | 217721 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 32 | 3246865 | 3247131 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 33 | 346231 | 346518 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 34 | 2054571 | 2054849 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 35 | 130724 | 131065 | - | NZ_CP020332.1 | Martelella mediterranea DSM 17316 |
| 36 | 575068 | 575352 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 37 | 695937 | 696227 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 38 | 676146 | 676385 | - | NZ_CP013416.1 | Burkholderia ubonensis |
| 39 | 880896 | 881204 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 40 | 4844891 | 4845181 | + | NZ_CP039546.1 | Methylorubrum populi |
| 41 | 485289 | 485585 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 42 | 936648 | 936932 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 43 | 4297889 | 4298179 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 44 | 1721064 | 1721351 | - | NZ_CP041352.1 | Casimicrobium huifangae |
| 45 | 1634995 | 1635285 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 46 | 451705 | 451998 | - | NZ_CP029556.1 | Lysobacter oculi |
| 47 | 3595712 | 3596005 | - | NZ_CP013236.1 | Collimonas pratensis |
| 48 | 1712300 | 1712539 | + | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 49 | 1586890 | 1587129 | + | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 50 | 3433829 | 3434119 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 51 | 1494427 | 1494711 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 52 | 3137345 | 3137629 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 53 | 762895 | 763185 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 54 | 913507 | 913803 | - | NZ_LT907988.1 | Orrella dioscoreae |
| 55 | 652507 | 652746 | - | NZ_CP013461.1 | Burkholderia stagnalis |
| 56 | 4341492 | 4341782 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 57 | 3968316 | 3968555 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 58 | 4283704 | 4283943 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 59 | 96830 | 97111 | + | NZ_CP071767.1 | Acinetobacter towneri |
| 60 | 3743804 | 3744106 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 61 | 4707274 | 4707513 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 62 | 3026356 | 3026595 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 63 | 133808 | 134095 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 64 | 1028113 | 1028352 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 65 | 2491945 | 2492253 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 66 | 1060053 | 1060289 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 67 | 1958854 | 1959147 | + | NZ_CP053073.1 | Usitatibacter palustris |
| 68 | 66814 | 67110 | + | NZ_CP011808.2 | Pandoraea faecigallinarum |
| 69 | 2388772 | 2389065 | - | NZ_CP028901.1 | Algicoccus marinus |
| 70 | 4424032 | 4424298 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 71 | 5137088 | 5137354 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 72 | 2308350 | 2308616 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 73 | 939514 | 939753 | - | NZ_CP020738.1 | Paraburkholderia acidophila |
| 74 | 832782 | 833021 | - | NZ_CP013452.1 | Burkholderia cenocepacia |
| 75 | 1176730 | 1177014 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 76 | 643281 | 643520 | - | NZ_CP009831.1 | Burkholderia multivorans ATCC BAA-247 |
| 77 | 739031 | 739270 | - | NZ_CP013403.1 | Burkholderia metallica |
| 78 | 306733 | 306972 | + | NZ_CP011504.1 | Burkholderia pyrrocinia |
| 79 | 1804596 | 1804835 | + | NZ_CP045236.1 | Burkholderia cepacia |
| 80 | 1696507 | 1696800 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 81 | 3433440 | 3433733 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 82 | 2644453 | 2644692 | + | NC_007511.1 | Burkholderia lata |
| 83 | 1271071 | 1271307 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 84 | 521686 | 521946 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 85 | 2746472 | 2746771 | - | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 86 | 1524993 | 1525232 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 87 | 3938250 | 3938513 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 88 | 1559939 | 1560241 | - | NZ_CP016023.1 | Ralstonia insidiosa |
| 89 | 2876013 | 2876249 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 90 | 3417906 | 3418190 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 91 | 735596 | 735835 | - | NZ_CP013400.1 | Burkholderia seminalis |
| 92 | 477788 | 478102 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 93 | 1427526 | 1427825 | - | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 94 | 3667773 | 3668012 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 95 | 637859 | 638143 | + | NZ_CP047165.1 | Pelistega ratti |
| 96 | 45105 | 45407 | - | NC_015059.1 | Granulicella tundricola MP5ACTX9 |
| 97 | 2336998 | 2337282 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 98 | 562057 | 562335 | - | NZ_LR134167.1 | Avibacterium volantium |
| 99 | 2442885 | 2443175 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 100 | 1933215 | 1933514 | + | NZ_CP012944.1 | Ralstonia solanacearum |
| 101 | 1922877 | 1923113 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 102 | 4266 | 4523 | + | NZ_CP044487.1 | Acinetobacter schindleri |
| 103 | 1821542 | 1821835 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 104 | 837337 | 837633 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 105 | 2704011 | 2704304 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 106 | 2520239 | 2520475 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 107 | 36652 | 36954 | + | NZ_CP064030.1 | Dyella caseinilytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040863.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05973.16 | 0.6 | 58 | 10.0 | same-strand | Phage derived protein Gp49-like (DUF891) |
++ More..