Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP009389.1 |
Organism | Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) |
Left | 1230086 |
Right | 1230349 |
Strand | + |
Nucleotide Sequence | GTGGCAGAGAAAGAGATGAATTTTGAAGAGGCGCTGGCCCGCCTGGAGGCTGTGGTAAAGGAACTGGAGGACGGCCGGTTACCGCTGCAGAAGGCGCTGGAACTGTTTGCCGAGGGAATCGGGCTTTCCAGGATATGCAACCGTTATCTGGAGGATGCCGAGCAGCGCATTGCAATTCTGACTGCTGACGAAAAGGGCGGTGTGGTGCTAAGAGAGCTGGGGCCTTCCCCGGCCGCAAGGGAGGACACAAATGATGAACTTTAA |
Sequence | MAEKEMNFEEALARLEAVVKELEDGRLPLQKALELFAEGIGLSRICNRYLEDAEQRIAILTADEKGGVVLRELGPSPAAREDTNDEL |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 18218977 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A5D2Z3 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2741007 | 2741258 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
2 | 3135580 | 3135819 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
3 | 2639964 | 2640191 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF20143.1 | 0.67 | 2 | 5137.0 | same-strand | ATP-NAD kinase C-terminal domain |
2 | PF01728.21 | 1.0 | 3 | 4203 | same-strand | FtsJ-like methyltransferase |
3 | PF01479.27 | 1.0 | 3 | 4203 | same-strand | S4 domain |
4 | PF13292.8 | 1.0 | 3 | 2271 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
5 | PF02779.26 | 1.0 | 3 | 2271 | same-strand | Transketolase, pyrimidine binding domain |
6 | PF02780.22 | 1.0 | 3 | 2271 | same-strand | Transketolase, C-terminal domain |
7 | PF00348.19 | 1.0 | 3 | 0 | same-strand | Polyprenyl synthetase |
8 | PF04961.14 | 1.0 | 3 | 112 | same-strand | Formiminotransferase-cyclodeaminase |
9 | PF02882.21 | 1.0 | 3 | 862 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
10 | PF00763.25 | 1.0 | 3 | 862 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
11 | PF13742.8 | 0.67 | 2 | 1673.0 | same-strand | OB-fold nucleic acid binding domain |
12 | PF01336.27 | 0.67 | 2 | 1673.0 | same-strand | OB-fold nucleic acid binding domain |
13 | PF14691.8 | 0.67 | 2 | 3144.5 | same-strand | Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster |
14 | PF07992.16 | 0.67 | 2 | 3144.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
15 | PF00070.29 | 0.67 | 2 | 3144.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
16 | PF10418.11 | 0.67 | 2 | 4550.0 | same-strand | Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B |
17 | PF00175.23 | 0.67 | 2 | 4550.0 | same-strand | Oxidoreductase NAD-binding domain |