Result : A5D2Z3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP009389.1 |
| Organism | Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) |
| Left | 1230086 |
| Right | 1230349 |
| Strand | + |
| Nucleotide Sequence | GTGGCAGAGAAAGAGATGAATTTTGAAGAGGCGCTGGCCCGCCTGGAGGCTGTGGTAAAGGAACTGGAGGACGGCCGGTTACCGCTGCAGAAGGCGCTGGAACTGTTTGCCGAGGGAATCGGGCTTTCCAGGATATGCAACCGTTATCTGGAGGATGCCGAGCAGCGCATTGCAATTCTGACTGCTGACGAAAAGGGCGGTGTGGTGCTAAGAGAGCTGGGGCCTTCCCCGGCCGCAAGGGAGGACACAAATGATGAACTTTAA |
| Sequence | MAEKEMNFEEALARLEAVVKELEDGRLPLQKALELFAEGIGLSRICNRYLEDAEQRIAILTADEKGGVVLRELGPSPAAREDTNDEL |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 18218977 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | A5D2Z3 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2741007 | 2741258 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 2 | 3135580 | 3135819 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 3 | 2639964 | 2640191 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021184.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF20143.1 | 0.67 | 2 | 5137.0 | same-strand | ATP-NAD kinase C-terminal domain |
| 2 | PF01728.21 | 1.0 | 3 | 4203 | same-strand | FtsJ-like methyltransferase |
| 3 | PF01479.27 | 1.0 | 3 | 4203 | same-strand | S4 domain |
| 4 | PF13292.8 | 1.0 | 3 | 2271 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 5 | PF02779.26 | 1.0 | 3 | 2271 | same-strand | Transketolase, pyrimidine binding domain |
| 6 | PF02780.22 | 1.0 | 3 | 2271 | same-strand | Transketolase, C-terminal domain |
| 7 | PF00348.19 | 1.0 | 3 | 0 | same-strand | Polyprenyl synthetase |
| 8 | PF04961.14 | 1.0 | 3 | 112 | same-strand | Formiminotransferase-cyclodeaminase |
| 9 | PF02882.21 | 1.0 | 3 | 862 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 10 | PF00763.25 | 1.0 | 3 | 862 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 11 | PF13742.8 | 0.67 | 2 | 1673.0 | same-strand | OB-fold nucleic acid binding domain |
| 12 | PF01336.27 | 0.67 | 2 | 1673.0 | same-strand | OB-fold nucleic acid binding domain |
| 13 | PF14691.8 | 0.67 | 2 | 3144.5 | same-strand | Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster |
| 14 | PF07992.16 | 0.67 | 2 | 3144.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 15 | PF00070.29 | 0.67 | 2 | 3144.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 16 | PF10418.11 | 0.67 | 2 | 4550.0 | same-strand | Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B |
| 17 | PF00175.23 | 0.67 | 2 | 4550.0 | same-strand | Oxidoreductase NAD-binding domain |
++ More..