Result : P44190
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1419 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1509962 |
| Right | 1510261 |
| Strand | + |
| Nucleotide Sequence | ATGACAATCCAAATCAAAACCACTCTGACATTTGATTCTTGGTTAAGCAAACTAAAAAACTTGCGTGCCAAAGCGAAAATAAACGCACGAATTAAACGCTTACAGTTCGGCAACTTTGGTGATATCAAAAGCGTGAATGATGGGATTTTTGAATTACGGATTGATGAAGGTCAAGGTTATCGAGTTTATCTTAAAAACCAGAATGGCGTATTAGTGATTTTACTTTGTGGCGGAGATAAATCCACACAAGATAAAGATATTAAACAAGCAAAACTTCTCGCACAGGAGCTAGGATTATGA |
| Sequence | MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRVYLKNQNGVLVILLCGGDKSTQDKDIKQAKLLAQELGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21503. Profile Description: ParE toxin of type II toxin-antitoxin system, parDE. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604. |
| Pubmed ID | 7542800 |
| Domain | CDD:419697 |
| Functional Category | Others |
| Uniprot ID | P44190 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 127
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 908288 | 908587 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 2 | 2707510 | 2707812 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 3 | 1241918 | 1242187 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 4 | 31743 | 32045 | - | NC_010697.1 | Erwinia tasmaniensis Et1/99 |
| 5 | 1560244 | 1560519 | - | NZ_CP016023.1 | Ralstonia insidiosa |
| 6 | 1375187 | 1375483 | + | NZ_CP016023.1 | Ralstonia insidiosa |
| 7 | 6067 | 6315 | - | NZ_CP019940.1 | Ketogulonicigenium robustum |
| 8 | 4112602 | 4112895 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 9 | 1272150 | 1272446 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 10 | 4434126 | 4434422 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 11 | 936350 | 936646 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 12 | 495950 | 496213 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 13 | 1509317 | 1509559 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 14 | 1788029 | 1788319 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 15 | 3874189 | 3874437 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 16 | 3205351 | 3205647 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 17 | 485588 | 485884 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 18 | 2929422 | 2929709 | + | NZ_CP064030.1 | Dyella caseinilytica |
| 19 | 1029525 | 1029779 | + | NZ_CP058670.1 | Chryseoglobus indicus |
| 20 | 3948747 | 3949049 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
| 21 | 5136776 | 5137018 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 22 | 2308686 | 2308928 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 23 | 4423720 | 4423962 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 24 | 2389069 | 2389326 | - | NZ_CP028901.1 | Algicoccus marinus |
| 25 | 1323635 | 1323934 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 26 | 2797806 | 2798093 | - | NZ_CP059082.1 | Halomonas titanicae |
| 27 | 4341240 | 4341482 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 28 | 1379517 | 1379813 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 29 | 3022476 | 3022733 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 30 | 2407409 | 2407714 | + | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 31 | 1615230 | 1615526 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 32 | 522016 | 522306 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 33 | 237007 | 237321 | + | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 34 | 131070 | 131366 | - | NZ_CP020332.1 | Martelella mediterranea DSM 17316 |
| 35 | 3627484 | 3627786 | + | NC_013530.1 | Xylanimonas cellulosilytica DSM 15894 |
| 36 | 2318109 | 2318405 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 37 | 134107 | 134397 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 38 | 136220 | 136522 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 39 | 867764 | 868093 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 40 | 524477 | 524788 | - | NZ_CP018762.1 | Microbacterium aurum |
| 41 | 691124 | 691387 | - | NZ_CP018762.1 | Microbacterium aurum |
| 42 | 913702 | 913950 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 43 | 3310325 | 3310621 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 44 | 1072058 | 1072372 | - | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 45 | 536858 | 537154 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 46 | 1830010 | 1830312 | + | NZ_CP060414.1 | Neisseria musculi |
| 47 | 2644072 | 2644389 | + | NC_007511.1 | Burkholderia lata |
| 48 | 268736 | 269038 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 49 | 4706909 | 4707205 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 50 | 1270711 | 1271001 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 51 | 2875653 | 2875943 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 52 | 96527 | 96829 | + | NZ_CP071767.1 | Acinetobacter towneri |
| 53 | 112569 | 112871 | + | NZ_CP071767.1 | Acinetobacter towneri |
| 54 | 1129605 | 1129907 | - | NZ_LT906434.1 | Neisseria zoodegmatis |
| 55 | 3026042 | 3026290 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 56 | 66511 | 66810 | + | NZ_CP011808.2 | Pandoraea faecigallinarum |
| 57 | 626847 | 627152 | - | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 58 | 1911999 | 1912292 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 59 | 1040012 | 1040350 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 60 | 617339 | 617590 | - | NZ_CP017477.1 | Polaribacter vadi |
| 61 | 3331624 | 3331929 | - | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 62 | 452001 | 452297 | - | NZ_CP029556.1 | Lysobacter oculi |
| 63 | 97423 | 97719 | + | NZ_CP035503.1 | Rhodoferax sediminis |
| 64 | 1660955 | 1661197 | + | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 65 | 1002524 | 1002820 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 66 | 1400183 | 1400521 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 67 | 2699605 | 2699856 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 68 | 1035399 | 1035650 | + | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 69 | 33965 | 34261 | - | NZ_AP021882.1 | Sulfuriferula nivalis |
| 70 | 2896783 | 2897121 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 71 | 33449 | 33751 | + | NZ_CP044484.1 | Acinetobacter schindleri |
| 72 | 254651 | 254953 | + | NZ_CP029396.2 | Acinetobacter defluvii |
| 73 | 3479902 | 3480219 | + | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 74 | 574753 | 575049 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 75 | 20796 | 21101 | - | NZ_CP038142.1 | Swingsia samuiensis |
| 76 | 3356313 | 3356621 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 77 | 1255146 | 1255439 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 78 | 2585029 | 2585328 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 79 | 4276699 | 4277016 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 80 | 3483752 | 3484042 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 81 | 3635639 | 3635938 | + | NZ_CP025938.1 | Tamlana carrageenivorans |
| 82 | 2520527 | 2520826 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 83 | 939817 | 940134 | - | NZ_CP020738.1 | Paraburkholderia acidophila |
| 84 | 424263 | 424553 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 85 | 81936 | 82259 | + | NZ_CP062808.1 | Cupriavidus basilensis |
| 86 | 785742 | 786023 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 87 | 3596015 | 3596257 | - | NZ_CP013236.1 | Collimonas pratensis |
| 88 | 3099403 | 3099681 | - | NZ_CP039546.1 | Methylorubrum populi |
| 89 | 3129839 | 3130156 | + | NZ_CP072793.1 | Thiothrix unzii |
| 90 | 1439450 | 1439749 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 91 | 2785722 | 2786024 | - | NZ_CP041637.1 | Formosa sediminum |
| 92 | 676449 | 676766 | - | NZ_CP013416.1 | Burkholderia ubonensis |
| 93 | 2613038 | 2613292 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 94 | 4106890 | 4107156 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 95 | 3679219 | 3679554 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 96 | 881777 | 882076 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 97 | 491251 | 491499 | + | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 98 | 1501216 | 1501470 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 99 | 3848202 | 3848507 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 100 | 6061352 | 6061621 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 101 | 1874648 | 1874947 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 102 | 733229 | 733519 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 103 | 1377899 | 1378201 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 104 | 1513341 | 1513634 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 105 | 31545 | 31841 | - | NC_010555.1 | Proteus mirabilis HI4320 |
| 106 | 3436430 | 3436744 | - | NZ_CP019607.1 | Tessaracoccus flavescens |
| 107 | 348787 | 349095 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 108 | 1641413 | 1641697 | - | NZ_CP009832.1 | Burkholderia multivorans ATCC BAA-247 |
| 109 | 1272423 | 1272719 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 110 | 2250888 | 2251139 | - | NZ_LR134503.1 | Kaistella jeonii |
| 111 | 3761191 | 3761508 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 112 | 3011804 | 3012136 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 113 | 3838299 | 3838604 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 114 | 1063297 | 1063605 | + | NZ_CP031844.2 | Bartonella krasnovii |
| 115 | 1852323 | 1852631 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 116 | 2814782 | 2815060 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 117 | 988121 | 988426 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 118 | 4376777 | 4377067 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 119 | 4590709 | 4591011 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 120 | 562361 | 562687 | - | NZ_LR134167.1 | Avibacterium volantium |
| 121 | 1433838 | 1434158 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 122 | 620209 | 620508 | - | NZ_CP063145.1 | Cruoricaptor ignavus |
| 123 | 3150413 | 3150724 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 124 | 291508 | 291834 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 125 | 1680303 | 1680605 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 126 | 1665759 | 1666055 | + | NZ_CP034562.1 | Flammeovirga pectinis |
| 127 | 731795 | 732145 | - | NZ_CP046531.1 | Mannheimia ovis |
| 128 | 1547201 | 1547524 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 129 | 1896221 | 1896478 | + | NZ_CP009793.1 | Burkholderia dolosa AU0158 |
| 130 | 179406 | 179654 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 131 | 2931140 | 2931454 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 132 | 261164 | 261481 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 133 | 2178677 | 2178973 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 134 | 3473787 | 3474134 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 135 | 2294970 | 2295278 | - | NZ_CP047045.1 | Terricaulis silvestris |
| 136 | 3415559 | 3415888 | - | NZ_LR134201.1 | Cedecea lapagei |
| 137 | 2858496 | 2858801 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 138 | 4121358 | 4121648 | - | NZ_CP045302.1 | Azotobacter salinestris |
++ More..