Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1414 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1507402 |
Right | 1507677 |
Strand | - |
Nucleotide Sequence | ATGACTAAGTACATTTACATAGCGTTAGTGGGTGTTGTCGTGGTTTTGTTTGGTGCATTGCGTTACCAATCTAGCGTTATAGATGAGTTGGAAATAACGACAAAGCAACAAGAAGATACTAACAAATCATTAAGTCTTGCGTTACAACAAGAGCGTAATGATGAAATAGAAAGGATAGCAACAGAAAATGCTGAATCAGTTAAAACAATCATTAAGACTCAACCTTGTGCTCACACTCGTTTGCCTCAGTCTGTTCTTGACCGCTTGCACGAATAA |
Sequence | MTKYIYIALVGVVVVLFGALRYQSSVIDELEITTKQQEDTNKSLSLALQQERNDEIERIATENAESVKTIIKTQPCAHTRLPQSVLDRLHE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl24005. Profile Description: Protein of unknown function (DUF2570). Members of this protein family are phage lysis regulatory protein, including the well-studied protein LysB (lysis protein B) of Enterobacteria phage P2. For members of this family, genes are found in phage or in prophage regions of bacterial genomes, typically near a phage lysozyme or phage holin. |
Pubmed ID | 7542800 |
Domain | CDD:420148 |
Functional Category | Others |
Uniprot ID | P44186 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1423244 | 1423567 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 663492 | 663770 | + | NZ_CP009610.1 | Haemophilus influenzae |
3 | 1370826 | 1371149 | + | NZ_LS483429.1 | Haemophilus aegyptius |
4 | 741389 | 741712 | + | NZ_LS483429.1 | Haemophilus aegyptius |
5 | 1471413 | 1471736 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06381.13 | 0.67 | 2 | 2538.0 | same-strand | Protein of unknown function (DUF1073) |
2 | PF04466.15 | 0.67 | 2 | 1318 | same-strand | Phage terminase large subunit |
3 | PF17288.4 | 0.67 | 2 | 1318 | same-strand | Terminase RNAseH like domain |
4 | PF03237.17 | 0.67 | 2 | 1318 | same-strand | Terminase large subunit, T4likevirus-type, N-terminal |
5 | PF03592.18 | 0.67 | 2 | 854 | same-strand | Terminase small subunit |
6 | PF01381.24 | 0.67 | 2 | 195 | opposite-strand | Helix-turn-helix |
7 | PF13560.8 | 0.67 | 2 | 195 | opposite-strand | Helix-turn-helix domain |
8 | PF12844.9 | 0.67 | 2 | 195 | opposite-strand | Helix-turn-helix domain |
9 | PF05106.14 | 1.0 | 3 | 562.5 | same-strand | Phage holin family (Lysis protein S) |
10 | PF10548.11 | 0.67 | 2 | 1196.5 | same-strand | P22AR C-terminal domain |
11 | PF02498.19 | 0.67 | 2 | 1196.5 | same-strand | BRO family, N-terminal domain |
12 | PF05766.14 | 0.67 | 2 | 1644.5 | same-strand | Bacteriophage Lambda NinG protein |
13 | PF07278.13 | 0.67 | 2 | 626.5 | same-strand | Protein of unknown function (DUF1441) |
14 | PF05876.14 | 0.67 | 2 | 1102.5 | same-strand | Phage terminase large subunit (GpA) |