Result : P44185

Protein Information

• Protein name: Uncharacterized protein HI_1413
• NCBI Accession ID: L42023.1
• Organism: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
• Left: 1507209
• Right: 1507490
• Strand: -
• Nucleotide Sequence: ATGCTGAATCAGTTAAAACAATCATTAAGACTCAACCTTGTGCTCACACTCGTTTGCCTCAGTCTGTTCTTGACCGCTTGCACGAATAAAATCACGACTAAACCAGAATATATTTATCCGCCTCAAGCCTATACTGCACCTTGTGTCAAAACAGCATTTACTGGGGAAACATACGGCGATGTAGTCATACAGTTAGTTAAGGTAACCGCAGAGCGAGATAAGTGCGCAAGCCAAGTAGATCATCTTAATAAGTGGATTAATCAAGCAAAAGGCGGTAAATAA
• Sequence: MLNQLKQSLRLNLVLTLVCLSLFLTACTNKITTKPEYIYPPQAYTAPCVKTAFTGETYGDVVIQLVKVTAERDKCASQVDHLNKWINQAKGGK
• Source of smORF: Swiss-Prot
• Pubmed ID: 7542800
• Functional Category: Others
• Uniprot ID: P44185
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1423051	1423332	-	NZ_CP009610.1	Haemophilus influenzae
2	663682	663963	+	NZ_CP009610.1	Haemophilus influenzae
3	1371061	1371342	+	NZ_LS483429.1	Haemophilus aegyptius
4	741624	741905	+	NZ_LS483429.1	Haemophilus aegyptius
5	1471648	1471932	+	NZ_LS483458.1	Haemophilus haemolyticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP009610.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF06381.13	0.67	2	2345.0	same-strand	Protein of unknown function (DUF1073)
2	PF04466.15	0.67	2	1125	same-strand	Phage terminase large subunit
3	PF17288.4	0.67	2	1125	same-strand	Terminase RNAseH like domain
4	PF03237.17	0.67	2	1125	same-strand	Terminase large subunit, T4likevirus-type, N-terminal
5	PF03592.18	0.67	2	661	same-strand	Terminase small subunit
6	PF01381.24	0.67	2	2	opposite-strand	Helix-turn-helix
7	PF13560.8	0.67	2	2	opposite-strand	Helix-turn-helix domain
8	PF12844.9	0.67	2	2	opposite-strand	Helix-turn-helix domain
9	PF10828.10	1.0	3	-88	same-strand	Protein of unknown function (DUF2570)
10	PF05106.14	1.0	3	797.5	same-strand	Phage holin family (Lysis protein S)
11	PF10548.11	0.67	2	1431.5	same-strand	P22AR C-terminal domain
12	PF02498.19	0.67	2	1431.5	same-strand	BRO family, N-terminal domain
13	PF05766.14	0.67	2	1857.0	same-strand	Bacteriophage Lambda NinG protein
14	PF07278.13	0.67	2	432.0	same-strand	Protein of unknown function (DUF1441)
15	PF05876.14	0.67	2	908.0	same-strand	Phage terminase large subunit (GpA)