Result : P44177
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1402 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1498837 |
| Right | 1499043 |
| Strand | - |
| Nucleotide Sequence | ATGCTCACACAAATTGCCCGAAATCGTGGTGTGCCGTTTGAAATATTGGTAGAAAAAGTGATTGAAAAATCCGCTCAGTTTGCCGTCGTGATTGGCATCATTATCGGGCAACGTCAAGCATTTGAAGACCGCTTACTGACATTTAACCCCCCCGAAGAATTAACCGCACTTGAACAGGAGATTGAACAATGGCAATTCCCAACATAA |
| Sequence | MLTQIARNRGVPFEILVEKVIEKSAQFAVVIGIIIGQRQAFEDRLLTFNPPEELTALEQEIEQWQFPT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44177 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 551031 | 551240 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 2 | 742115 | 742324 | + | NZ_CP031253.1 | Neisseria lactamica |
| 3 | 1177272 | 1177481 | + | NZ_CP031253.1 | Neisseria lactamica |
| 4 | 718367 | 718576 | + | NZ_CP021520.1 | Neisseria meningitidis |
| 5 | 2139891 | 2140100 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906463.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07484.14 | 0.75 | 3 | 1694 | same-strand | Phage Tail Collar Domain |
++ More..