Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1280 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1356988 |
Right | 1357263 |
Strand | + |
Nucleotide Sequence | TTGCTTACATTTTGGCACTGGAAATGGCTAGGGATTAAGAATACCGAGTTCAAGTGTGTGAAAGGCAAGCTCTATTTATCCCCAATTAAGGATTTATTTAACAATGAAATTATTGCTTATGATTTAGTGCGAAGCCCGAATTCTGAGCAAATTACCCAAATGATGAAACAAGCTGTAGCAAGGCTTGCAGGCGCAAAACCGATTTTACATTCCGACCAAGGTTGGCAGTATCAGATGATAGGTTATCAAAACATACTTAGGGAGAATGGCATTTAA |
Sequence | MLTFWHWKWLGIKNTEFKCVKGKLYLSPIKDLFNNEIIAYDLVRSPNSEQITQMMKQAVARLAGAKPILHSDQGWQYQMIGYQNILRENGI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl21549. Profile Description: Integrase core domain. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. |
Pubmed ID | 7542800 |
Domain | CDD:419726 |
Functional Category | Others |
Uniprot ID | P44151 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2171039 | 2171296 | + | NZ_LR134313.1 | Neisseria canis |
2 | 2720464 | 2720751 | - | NZ_CP029256.1 | Christensenella minuta |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13518.8 | 1.0 | 2 | 355.0 | same-strand | Helix-turn-helix domain |