Result : P44148
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1269 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1347628 |
| Right | 1347744 |
| Strand | + |
| Nucleotide Sequence | ATGTTGAATGGTAAGGCGAATGCTGACTTTGTGCCTGAAATGCAACGTTTCTATAAATTGTTCTATCACATTGATTTAACCAATGAACAAGCACTTAAGTTGTTTCAAGTAAAATGA |
| Sequence | MLNGKANADFVPEMQRFYKLFYHIDLTNEQALKLFQVK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44148 |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1643547 | 1643663 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 1480730 | 1480849 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 3 | 182532 | 182651 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 4 | 3777194 | 3777301 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483443.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 4 | 1010 | same-strand | ABC transporter |
| 2 | PF02463.21 | 0.75 | 3 | 1010 | same-strand | RecF/RecN/SMC N terminal domain |
| 3 | PF01032.20 | 0.75 | 3 | 0 | same-strand | FecCD transport family |
++ More..